KEGG   Pocillopora damicornis (lace coral): 113678131
Entry
113678131         CDS       T05773                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
pdam  Pocillopora damicornis (lace coral)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 ASD1 ARF7EP_C
Other DBs
NCBI-GeneID: 113678131
NCBI-ProteinID: XP_027050798
LinkDB
Position
Unknown
AA seq 470 aa
MRTELQNGNRNLPKNRILEWLTSRLLLIFERGLFALLYLLTRSTGFEMESDDVFSNEATK
PRDPNSLDRKRAQIKSHMANDVRDRNRAISVPHMPGEKHTASNPVKDFISNFVNRKGPKK
RSTIKRSVTTENVSDEKALVRHVGRGHTFIQHQLRNPTWCDCCGEFIWGLFKQCVRCKNC
KYTCHRRCKEDVDLDCTGGWLYERMMSVDEVTMKTLHLVDQGEKRKEPFMLYTDSPTGSL
LRVKIDEYNSSTTGLIMSMRTEDTYQGFIRVNMNLLRPIHIIEGERPLSIFQTAVKSKDD
DDLNQKTSQRTSFFLPLETEKALHVTSETTVHQVIVALLKKFKVADNPRKFALFECYQEE
DDHIILRRMSDFEKPLVLRLLWGGADLRHKFSLQENETGDIVWEVFSIPELQNFMKILDK
EEEEHILQVEEKYRLYKERLEQALALVQPNQTVCDEEKPPSDESGETARL
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcgaactgaattgcagaacggcaatcgtaatttgcccaagaatagaatcctcgagtgg
ttaacttcgagattgttgctcatttttgaaagaggtttgtttgccttgctttatttgtta
acacgatcaactggttttgaaatggaaagtgacgatgtgttctcgaacgaagcaacgaaa
cctcgagatcccaactctctagatagaaaacgtgctcaaatcaaatctcacatggcgaac
gatgttcgggacagaaatcgcgccatatctgtacctcatatgcccggagagaaacatact
gcaagtaatccagtgaaagatttcatctcgaactttgtcaataggaaaggacctaagaaa
cgaagcaccataaaacgatctgtgaccacggaaaatgttagcgacgagaaagcgctagtt
agacatgtcgggagaggacatacgtttattcaacatcaactacgaaatcctacatggtgc
gattgttgtggagagtttatttggggacttttcaagcaatgtgtgcgctgcaaaaattgc
aagtacacttgtcacagacgatgcaaggaggatgtggatttagactgtactggaggctgg
ctgtatgaaagaatgatgtcagttgatgaggtgaccatgaagacattgcatcttgtagat
cagggagagaagaggaaagaaccgtttatgctgtacacagactccccaacaggaagcctt
cttcgtgtgaaaattgatgaatacaattcaagcacaactggacttataatgtctatgagg
actgaggacacataccaaggctttatccgtgttaatatgaacttactccgtccaatccac
atcatcgaaggagagagacccctgtcaatttttcagaccgctgtaaagtcaaaggatgat
gatgatctgaatcagaagacttcccagcggacatcatttttccttccacttgagactgag
aaagctttacatgtaactagtgaaactactgttcatcaggtcattgtagctcttctcaag
aagttcaaagttgctgataatccaagaaaatttgcattatttgagtgttaccaggaagaa
gatgaccatattattcttcgtcggatgtctgactttgagaaacccctggtgctaaggtta
ctttggggtggagcagatttaagacacaaattctcactccaggagaatgaaacaggagat
attgtgtgggaggtattctccataccagagcttcaaaatttcatgaagatactggacaaa
gaagaggaggaacacatattgcaggtggaagaaaagtacagactttacaaggaaagatta
gagcaggctttggcactggtacaaccaaaccaaacagtctgcgatgaagaaaaaccacct
tctgatgagtctggtgaaacagcaagattataa

DBGET integrated database retrieval system