KEGG   Pocillopora damicornis (lace coral): 113679814
Entry
113679814         CDS       T05773                                 

Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04137  Mitophagy - animal
pdam04140  Autophagy - animal
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113679814
   04137 Mitophagy - animal
    113679814
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113679814
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pdam01009]
    113679814
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pdam03036]
    113679814
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdam02000]
    113679814
Protein phosphatases and associated proteins [BR:pdam01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     113679814
Chromosome and associated proteins [BR:pdam03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    113679814
Transporters [BR:pdam02000]
 Other transporters
  Pores ion channels [TC:1]
   113679814
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 113679814
NCBI-ProteinID: XP_027052585
LinkDB
Position
Unknown
AA seq 187 aa
MLKKIQSPMESRHKLPSADDSPIAQQAKDLAKDFISYRLGNNPIPVSPTAATLRKLADQI
EEQYPLLLNHLCHKLNITPATVYQTFFEIASEVFVDGVNWGRIVALYAFGGKLAMYCDQH
HMKELVGSVTDWVGRYVGGLCEWIENHGGWEGLHRQFNDKGENAAWWKGVFLTTLGLGTL
AAFMYSR
NT seq 564 nt   +upstreamnt  +downstreamnt
atgctcaaaaaaattcaaagccccatggaaagccgacacaaactgcccagcgcggatgat
tcgccgattgcccaacaagccaaggatctagccaaagatttcatatcttacagacttgga
aataacccaatccctgtatcacccactgctgctactctacgcaaacttgccgatcaaatc
gaggagcaataccctttactattgaaccatttgtgccacaaattaaatataactccagca
actgtctatcaaacgtttttcgaaatcgccagtgaggtatttgtagatggagttaactgg
ggaaggattgtagctttgtatgcctttggaggaaagctggctatgtattgcgatcaacac
catatgaaagagcttgttggatcggtaactgactgggttggaagatatgttggcggcctt
tgtgaatggatcgaaaaccatggtggatgggaaggcctccatagacaatttaatgacaaa
ggcgaaaatgcagcatggtggaaaggtgtctttctcactacactgggacttggcacatta
gcagcttttatgtacagcagatga

DBGET integrated database retrieval system