KEGG   Pocillopora damicornis (lace coral): 113681105Help
Entry
113681105         CDS       T05773                                 

Definition
(RefSeq) DNA repair protein complementing XP-G cells homolog isoform X1
  KO
K10846  DNA excision repair protein ERCC-5
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    113681105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pdam03400]
    113681105
DNA repair and recombination proteins [BR:pdam03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     113681105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_I XPG_I_2
Motif
Other DBs
NCBI-GeneID: 113681105
NCBI-ProteinID: XP_027054009
LinkDB All DBs
Position
Unknown
AA seq 176 aa AA seqDB search
MDGIRAEQKSLAAELARQNRRAATVTPEMYIDCQKLLLKFGVPYVISPTEAEAQCAALEL
AGKSDGTISDDSDIFLFGSKRVYRNIFDTKMEAEEYTSDAVKRKLLLDRSSLICLAFITG
SDYTDGLKGFGGVNAVEILHEFSIKDFEGLEQFREVWCCQVTFHLKQFMTLIAIRR
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggatggcatacgggcagaacagaagtctcttgcagcagaacttgccaggcagaatcgc
cgggcagctacagtgacccctgagatgtacatcgattgtcagaaactactactgaagttt
ggtgttccttatgtgataagtccgaccgaagccgaagcccagtgcgccgcattagaacta
gctggtaaatcagatggaactatttcagacgacagtgatatattcctctttggtagcaaa
cgagtgtatagaaatatcttcgacactaaaatggaagcagaggaatacacaagtgatgca
gttaagagaaagctacttctagaccgttcgagtcttatctgcctcgccttcatcaccggc
agcgactacactgatggcttaaaagggtttggaggagttaatgccgtggagattcttcac
gagttttctattaaagatttcgagggtcttgagcagtttagagaggtgtggtgctgccaa
gtgactttccatctaaagcagtttatgacgcttatagcaatccggcggtag

DBGET integrated database retrieval system