KEGG   Pocillopora damicornis (lace coral): 113681677
Entry
113681677         CDS       T05773                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113681677
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 113681677
NCBI-ProteinID: XP_027054586
LinkDB
Position
Unknown
AA seq 109 aa
MGDIPIGDATKGAKIFKTKCAQCHTVEANGKHKTGPNLHGLFGRKTGQAPGFSYTDANKN
KGITWGPDTLWIYLENPKKYIPGTKMVFAGLKKKTERADLIAYLKEATS
NT seq 330 nt   +upstreamnt  +downstreamnt
atgggtgatattcctattggagacgccacaaagggggccaagatcttcaagactaaatgt
gcacagtgtcacacagtagaggcaaatggtaagcataagacgggtccgaaccttcatggc
ttgtttggtcgcaaaactggacaggcaccaggtttctcttacactgatgctaacaagaac
aagggcatcacatggggcccagacactctgtggatttacctggaaaaccccaagaagtac
attcctggaacaaagatggtctttgctggtctaaagaaaaaaactgagagagcagatctc
attgcttacctgaaggaggccacaagctga

DBGET integrated database retrieval system