KEGG   Pocillopora damicornis (lace coral): 113682506Help
Entry
113682506         CDS       T05773                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00020  Citrate cycle (TCA cycle)
pdam00190  Oxidative phosphorylation
pdam01100  Metabolic pathways
pdam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113682506
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    113682506
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     113682506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 113682506
NCBI-ProteinID: XP_027055469
LinkDB All DBs
Position
Unknown
AA seq 285 aa AA seqDB search
MATATVVCARNITTKALQLRPAVAISKILVRDATSASDSPRMKTFSVYRWDPDKPGDKPR
MQEYQVDLNRCGPMVLDALIKIKNEDDPTLTFRRSCREGICGSCAMNIGGTNTLACISRI
NPDEGKKTKIYPLPHMYVVKDLVPDMNNFYEQYRSIEPYLQKKTEVEYGKEQYLQSIEDR
KKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAKLDSD
PFKVYRCHTIMNCTKTCPKGLNPGKAIAEIKKMLATYQGKKAATA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgcaactgtagtctgtgcaagaaacataactaccaaagccctgcagttacga
ccagcagtggctatttctaagattctggtgcgagatgctacatcagctagtgacagtcct
cgaatgaaaacattttctgtttatcgttgggatccagacaagcctggtgacaaacctagg
atgcaggaatatcaagttgatctaaaccgatgtggtccaatggtccttgatgcattgata
aagataaaaaatgaagatgatccaacactgacattcaggagatcatgtagagaaggaatc
tgtggctcgtgtgccatgaacattggaggaacaaacacattagcttgtataagtcgcatc
aacccagacgagggaaagaaaaccaagatctatccactgccacacatgtatgtggttaaa
gatcttgtgccagatatgaacaacttctacgagcagtatcgctcaattgaaccttacctc
caaaagaagactgaggtggaatatggaaaggaacaatacttgcaatcgattgaggacagg
aagaaactggatggattgtacgagtgtatcctgtgtgcatgttgcagcacttcttgtccc
agttactggtggaatggtgacaagtaccttggacctgcagtcctcatgcaggcttaccgc
tggatgattgacagtcgggacgactacactgaagaacgtttggctaaactggactctgat
ccattcaaagtatacaggtgtcataccatcatgaactgtaccaagacttgtcctaaggga
ttgaatccaggaaaagccattgctgagataaagaaaatgttagcaacataccaggggaag
aaggctgccacagcttag

DBGET integrated database retrieval system