KEGG   Pocillopora damicornis (lace coral): 113682606
Entry
113682606         CDS       T05773                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113682606
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113682606
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     113682606
Peptidases and inhibitors [BR:pdam01002]
 Cysteine peptidases
  Family C14: caspase family
   113682606
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 113682606
NCBI-ProteinID: XP_027055568
LinkDB
Position
Unknown
AA seq 523 aa
MNSFSETNRILYKISNEMRDRDLQNIKHLCHGRIPLGDLEKSESPSILFQIMLQRRMISP
GNLSHLERLLTQIGRADLAGKIQTNGNDTTMETESAVSSNPIDKSYKAFLMKLSDELTRD
NVDSLKFVSDLPDGIDENVQNGKDLFKYMIQCGSIGPCNLDHLADIWITCMFYLFNLGGV
SSSAAKIDRPAQSPINDQRPFASTQAPPLRPLVTGKQPIVHQMGETRPLSAPLLSPAHFM
GGRDGGPDSIEPRFPVQALANPAEIVAPMRQLGVDEEDAMPSYPMRNRPRGIALIISNEH
FQGNPDLRDRQGNQKDVDQLRELWEFLHFEVIVRAELQSHEMYDCMRGISTMDHSNFDCF
VCCLLSHGANGAIYGTNSELLEINTITSMFKGVACPSLANKPKLFFIQACRGEAFDRGAW
IEADAVESNPEDAMRNNAEPNESHFLLGYATPPGYVSWRSQIHGSWYVSKLCEVFRKYCE
RYDVTTMMVKVNDEVSDAFTKRGYKQCPAPVVTLRKRIYLNKN
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgaatagcttctcggagactaaccgtatcctgtataagatttctaacgagatgagagat
cgggatcttcaaaatataaagcacttgtgccacggacggatacctttgggcgacctcgaa
aaatcggagagtccaagcatcttgttccagatcatgcttcagagacgaatgataagtccg
ggtaatttgagtcatttagagcgcttgttgactcagattggtagagcagatctagctggt
aagattcaaacgaatggtaacgacaccacgatggaaacagagagcgccgtgtctagcaat
ccaatcgacaagagttataaagctttcctgatgaaacttagtgatgaattaacgagagat
aacgtcgactcgttgaagtttgtttctgatttaccggatggcattgatgaaaatgtgcag
aatggaaaagacctcttcaagtatatgattcaatgtggcagtattggaccttgtaatttg
gaccaccttgctgacatttggataacttgcatgttttatctttttaatttaggaggtgta
agttccagtgcggccaaaattgaccggccagctcaatcaccaatcaatgaccaacgccca
tttgcatcaactcaagccccaccactcagacctttagttactgggaagcagccaatagtg
caccagatgggtgagacaagaccactaagtgcacctttactttctcctgcacatttcatg
ggtgggcgggatggaggtccagacagcattgaacctcgattccctgtccaggcactggct
aatccagcagaaatcgttgctcccatgcggcaactaggggttgacgaggaagatgcaatg
ccttcctatcccatgagaaaccggccacgtggtattgcactgattataagtaatgaacac
ttccagggaaaccctgatttgagagaccgccaaggaaatcaaaaggatgtggatcagctc
cgtgaactatgggaattcttgcattttgaagtaattgtcagagcagagctgcagtcacat
gaaatgtatgattgtatgagagggatctcaacgatggatcactcaaactttgactgcttt
gtttgctgcttgcttagccatggagccaatggagcgatctatggcacaaatagtgaattg
ctggagataaataccattacatccatgttcaaaggcgtggcctgcccatcacttgctaac
aaacccaaattgttcttcatccaagcttgcaggggggaagcgtttgatcgaggagcttgg
attgaagctgatgcagtagaaagcaatcctgaagatgccatgaggaataatgcagagcca
aatgaaagccattttctcttgggttatgccacccctccaggttatgtcagctggagaagt
caaatccatggctcctggtatgtttccaagctttgtgaagtgttccgaaagtattgtgag
agatatgatgtgacgaccatgatggtgaaggttaatgatgaagtgtcagatgcattcacc
aaaaggggttacaaacagtgcccagctcctgttgtcacactcaggaagagaatctactta
aacaaaaactga

DBGET integrated database retrieval system