KEGG   Pocillopora damicornis (lace coral): 113683455
Entry
113683455         CDS       T05773                                 

Definition
(RefSeq) uncharacterized protein LOC113683455
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113683455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdam01001]
    113683455
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pdam04090]
    113683455
Enzymes [BR:pdam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     113683455
Protein kinases [BR:pdam01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   113683455
CD molecules [BR:pdam04090]
 Proteins
  113683455
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Laminin_G_3 fn3 Kinase-like DUF485 Baculo_11_kDa APH
Other DBs
NCBI-GeneID: 113683455
NCBI-ProteinID: XP_027056494
LinkDB
Position
Unknown
AA seq 1187 aa
MAHLSSFYFATNPAYEILILKISMCICVIEAQNVGEFFATTVNQTEFQIHQKIVIYFTNL
PLFKICRVAATKKELNQTLRDHHQLGSQTAKLRMGSLWVSVIVMAFLGFTIPISAYSDCT
QVDWNITLGSAGWASCPLGKYLKGVLRAHISNSDGIDNIKAGQCCIPPHEFLDEDTECKT
ENWKKSLSRNHKWASCPEDYDFLRGFYHSNETFLDNIEQALCCRPKTYISRTTDCYFEDV
GQKLDTEGWNTCRDWYYMAGVYRGGCNALSCIETLKCCKITAQDGVVLDHWLLNGQDGNV
SLSGSPSFTKGRCPSSNAITFNQSSSYASVPLINLGGRSFTIACWIKQTKSVKDEIAAIY
GDWRRPWNFLLSLKNREIIFHRPRERYGERQWWSAGSADVSFDAWTHVVVIWDHKKTAVS
ILADGLKVGGNSFSSEDAFYEPTGNRYQIGDDGHWGDHQFYGSVMDLYVFGSALSLEQVN
KLRGVPLIANTTKSVSGGDVLVVWEPPLVGACPIVKYNVYYREVMSSARQQSNWYSVELD
GGRTSCTLHLSCRKEYNVSVTSISESGESPFSDSKIWNFQTTGGIPSPPIITPMKQEISS
NNITLSWSPQTANACPLTMYSIHYRLIYPGGAGESWNQVNVTNVTKTSHTVSLEYDRQYT
IEMSAWNELGQSAKSRPWIITTASSGSIHRTAEKGTVKSSVSGSGKILSTPQLAGLLVGV
CILLFVVLIAVIYLRRAARKSRKHASALRLRRSKSTIFTLHNWEVLPEQVVFGEEIGRGA
FGKVLKGTFRESPGTEVFIEPRYETVDFKPGETVAIKLLGDKTGEEARNQFLEEIELMKS
IGSHPNVVRMLGCWVHSDPIFLLLEYVSYGDLLQWLRNKRIQKSYQKHYDNFNKPLQLDT
NLVQINEDESRELLSRSEEESGKDPDTKGIPKAVSTSVSVCASGIESVSKEKTPAINEAK
TDVTEKVQNHYDKHPIQASLSDCHNNVEWDEDFTAKDLLGFAWQVARGMAYLSGKGFVHR
DLAARNVLLDENKVVKISDFGLMRQTHENVYTLKKGKKIPVKWMAPEALYNSEYTTKSDV
WSFGILLWELSTMGGNPYPGVNNKELYNLLKTGYRMEKPDTSSDTLYQLMSECWKEEPSE
RPTFENTTRLLEEMMQEDTPYLDFESLDESKEYYCSPEKLSDDEVTA
NT seq 3564 nt   +upstreamnt  +downstreamnt
atggcgcatcttagctctttttacttcgccacaaatcctgcctatgaaatattaattctg
aagatctcgatgtgcatttgcgttattgaagcccagaatgtcggcgagttcttcgctacg
actgtgaaccaaaccgagttccagattcatcagaaaatcgtgatatacttcacgaatttg
ccattgttcaaaatctgccgtgttgctgcaactaagaaagaactcaatcagaccttgaga
gatcatcatcaactggggagtcaaacagctaaattacgaatgggatctctctgggtgtcc
gtcatcgtgatggcttttttgggattcaccattccaatatcggcttacagcgactgcact
caagtagactggaatatcactctaggtagtgcaggatgggcgagctgcccacttggaaag
tacctgaaaggagttttgagggcgcatatcagcaactccgacggtatcgataacatcaaa
gcagggcaatgctgcattccacctcatgagtttctggacgaggatactgagtgtaaaaca
gagaactggaaaaaatcattaagcagaaaccacaagtgggcttcctgtcctgaagactat
gattttctaagaggattttatcattcaaatgaaacttttttggacaacatcgagcaagcc
ttgtgttgcaggccaaagacctacataagtaggaccacagattgctactttgaagatgtg
ggacaaaaacttgatacagagggctggaacacgtgtcgagactggtattacatggctgga
gtgtacagaggagggtgcaatgccttaagctgtattgagacattaaagtgctgcaaaatt
acggcacaagatggagtagttctagaccactggctacttaacggtcaagatgggaatgta
agtttatctggttcgccatctttcaccaagggtcgatgccccagcagcaacgctattact
tttaaccaatcgagttcgtatgccagcgtgcctctaataaatcttggaggccgaagtttt
acaattgcctgttggattaaacaaacaaaaagcgttaaggatgagattgcagcaatatac
ggtgactggcgaagaccatggaattttttgctaagtctaaaaaaccgagagattatcttc
catcgtcccagagaaagatacggagaaagacaatggtggtccgcaggaagtgctgatgtt
tcttttgacgcttggactcacgtggttgttatatgggatcataaaaaaaccgccgtgtcg
atattagccgacgggttaaaagtggggggaaactctttttcatcagaggatgcgttttac
gaacctacagggaatcggtaccagatcggtgatgacgggcactggggtgatcatcagttc
tatggatcagtgatggatctttatgtgtttggctcggcactgtcgctggaacaagtcaac
aaactaagaggagttccgcttatcgctaacacgaccaagagtgtatcagggggggacgtc
ctagtggtgtgggaacctcctttggtaggagcatgtccgattgtcaaatacaatgtgtat
tacagagaggttatgtcatcagcaagacaacaaagcaactggtactcggtagagttggac
ggaggtcgcacaagttgtacgcttcatttgagctgcaggaaagaatacaatgtgtctgtt
acctcgattagcgaatcaggggagagtccattcagtgacagcaaaatttggaatttccaa
accaccggaggcattccttcacctccaattataacccctatgaaacaagaaatatcgagt
aacaatatcaccttatcctggagtcctcaaacagccaatgcttgtccgctgaccatgtac
tcaatacactatcgactgatttatccgggaggagcaggggagtcctggaaccaagtcaat
gtcacaaatgttacgaagacaagccatactgtatcgttagagtacgacaggcaatacaca
attgaaatgtcggcgtggaatgagctgggacagagtgcaaagtcgaggccatggataata
acaacagcatcatcaggttcaattcataggactgctgaaaaaggcacggttaaatcttca
gtctcaggcagtggtaaaatcctttcaacaccacagcttgctggtttattagtgggtgtt
tgcatccttctgttcgtagttttaatcgcagtaatctacctgagacgtgcagcaagaaaa
agcagaaaacatgcttctgccctaaggctcaggagatcgaagtccaccatttttaccctc
cataactgggaagttcttccggagcaggttgtattcggggaagagattggtcgcggggca
tttggtaaggtattaaaaggcaccttcagagaatcacctggaactgaggtcttcatcgag
cctagatatgagacggtcgacttcaaaccaggagaaacagtggccattaaactcctggga
gacaagacaggcgaagaggcacgaaaccagtttttggaggaaattgaacttatgaaatca
atcggctcacatcctaatgttgttagaatgttgggatgctgggtacactcggatcctatc
tttctcctcttggaatacgtttcttacggggatttgttacagtggctaagaaacaaaagg
atacaaaagagttatcaaaagcattatgataacttcaacaagcctctgcaacttgataca
aatctggtgcagattaacgaagatgagtccagagaactgctatcaaggagtgaagaagaa
agtggaaaggatccagacaccaagggtattcctaaggctgtttcaacctcagtttctgtc
tgcgcctcgggtattgaaagtgtctcgaaggaaaagacacccgccataaatgaagcaaaa
actgacgtgacagaaaaggtgcagaatcattacgacaaacatcctattcaagcctctcta
agtgattgtcataataatgtggaatgggacgaagacttcacagctaaggatcttcttggt
tttgcgtggcaagtagcgcgcggaatggcgtatttatcaggtaaaggatttgtccatcgc
gatttggcagctcgtaatgttcttcttgatgaaaacaaagtggtgaaaatttctgatttt
ggacttatgaggcaaacccatgaaaacgtgtacacgctgaagaaagggaaaaagatacca
gtaaaatggatggcgccagaagcactttacaacagtgaatatacaaccaaaagtgatgta
tggtcttttggaattctcctctgggaactttccacaatgggaggaaacccttacccagga
gtcaataacaaagagttgtacaatcttcttaagactggatatcgaatggaaaaaccagac
acctcttctgatacattatatcaactgatgtcagagtgttggaaagaggagcccagtgag
agaccgacttttgaaaacaccacgagattattagaggaaatgatgcaagaggacacgcct
tatttggattttgaatcacttgatgagtcaaaggagtattactgcagtccagaaaagctt
tctgatgatgaagtcacagcttaa

DBGET integrated database retrieval system