KEGG   Pocillopora damicornis (lace coral): 113684402Help
Entry
113684402         CDS       T05773                                 

Definition
(RefSeq) peroxisomal multifunctional enzyme type 2-like isoform X1
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam01040  Biosynthesis of unsaturated fatty acids
pdam01100  Metabolic pathways
pdam01212  Fatty acid metabolism
pdam04146  Peroxisome
Module
pdam_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    113684402
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113684402
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     113684402
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     113684402
    4.2.1.119  enoyl-CoA hydratase 2
     113684402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 MaoC_dehydratas SCP2 KR MaoC_dehydrat_N Alkyl_sulf_C
Motif
Other DBs
NCBI-GeneID: 113684402
NCBI-ProteinID: XP_027057572
LinkDB All DBs
Position
Unknown
AA seq 738 aa AA seqDB search
MADELRFDGRVVLVTGAGGGLGKEYALAFASRGASVVVNDLGGDAKGGGKSSAAADKVVE
EIRSRGGKAVADYNSVEDGEKVIQTALDAFGRIDVLINNAGILRDRSFGRISDVDWDLVH
RVHLRGSFKVTRAAWPHMRKQKYGKIIMTSSTSGVLGNFGQANYSAAKMGLIGLTNTLAI
EGEKYNVVCNTIVPTAGSRLTKGLLPPDVFDALKPEYVAPFVVYLCHESCPESGGVFEMA
SGWGAQLRWQESSGAMLRKGGVTVTPEMVRDNWCKITDWSGPVKPKLRGDAMTDLIPIIQ
EANTTVPESGKASSKTLEIRESQCTFEAKDVILYALGVGVTVQEDSSHLKFLYEGCDDFC
TLPTFGVIPAQSAMNTVIVRAVEQAGLPFNPAKLLHGEQYLELYKPLPTSGTLTSKGEVA
DILDKGKGAIVLVNITSYDSSGEAVCFNQFSIYIGGAGGFGGKKRSEYSKPLVTMPTRAP
DASVREKTDVSVAAIYRLSGDLNPIHIDPDFAQLGGFSRPILHGLSTFGHAARHVLKQYA
NNDVSKFKAIKARFSKPVFPGQTLQTDMWRDGNRISFQCKLVENGNVVLSGAYIDLKDVD
VAVKKVPSLQDINALVSHPSKSGLKSEALFNEISKRVSDHPELVKKVKGVFEWNVTKGGK
TAGQWTVDLKSGSGSVTVGPYKQGKPDCSITVEDDDLSSMATGKSNPQQLFMKGKLKVKG
NIMLTAKLAQLFKDNAKM
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgagttgagattcgatggccgtgtagttcttgtaacaggggcaggaggaggg
ctcgggaaggagtatgcactcgccttcgcttccagaggcgcctcggttgttgtcaatgat
cttggtggagacgcaaagggcggaggaaaaagcagtgcagcggccgacaaggttgttgaa
gagatccgctctcgtggaggaaaagcggtagctgattacaactccgtggaagacggcgaa
aaagttatacaaacggcattagatgcatttggtcggattgatgtcctcatcaacaacgct
gggattcttagagatcgatcgttcggtcgcataagtgatgtcgattgggatctcgtccac
cgtgttcacctccgaggatcgttcaaagtgacccgagcagcttggcctcatatgcgaaaa
cagaagtatggtaagatcattatgacttcctcaacctctggtgtgttagggaattttggt
caagcgaactacagcgcagctaaaatgggtcttattggtctaactaacacattggccatt
gaaggagaaaagtataatgtggtctgtaatactattgttccaactgctggatcaaggtta
actaagggactactgccccctgatgtctttgacgcccttaaaccagagtatgttgctcct
tttgttgtgtatctttgccacgagagctgtccagagagtggtggtgtctttgagatggct
tcaggttggggggcacagttaaggtggcaggagagttcaggggcaatgctaagaaaaggt
ggtgttactgtgacaccagagatggtgagagacaactggtgtaagatcactgactggtct
ggtcctgtgaagccaaagttaaggggtgatgccatgactgatctgatcccaataatccaa
gaagctaacacaacagtaccagaaagtggaaaagcttcaagcaaaacactggaaattcga
gagtcacagtgtacttttgaagccaaggatgtgatcctgtatgcacttggggttggggtc
actgtgcaggaagactcatctcaccttaagtttctttatgagggatgtgatgacttttgc
accttacctacctttggagtaattccagctcagtcagcaatgaatactgttattgtgaga
gcagtggagcaagctggacttccttttaatccagcaaagctcctccatggggaacagtat
ctggaactttataaacccttgcctacttcaggaaccttgacaagcaaaggagaggttgct
gacatccttgacaaagggaaaggagccatagtgctggtgaacatcactagttatgacagc
agtggtgaagcagtgtgtttcaatcaattctccatctatattggtggtgctggggggttt
ggaggaaaaaaacgctcagagtattccaagcctcttgttacaatgccaacccgtgcacct
gatgccagtgtcagggagaagactgacgtttctgtagcagcaatttatcggttgagtggt
gatctaaatccaatacatattgatccagattttgcccagttaggaggtttttcccgccct
atccttcacggtcttagtacatttggtcacgctgctcgtcatgtgctgaagcagtatgca
aacaatgatgttagcaaattcaaggccatcaaagcaaggttttctaaacctgttttccct
ggtcagacactgcagactgacatgtggcgcgatggcaacaggatttcatttcagtgcaaa
ttggttgaaaatggtaatgtggtgctgtcaggggcatatattgacttgaaggatgtcgat
gttgctgtaaagaaagtgccgtctctacaggacataaatgcattggtgtcccacccaagc
aaatcaggccttaagagtgaagctctgtttaatgagatcagcaaacgagtctcagaccac
ccagaacttgtcaagaaggtcaaaggtgtctttgaatggaatgtgacaaaaggggggaag
actgctggtcagtggactgtggaccttaagagtggatctgggtctgtgacagtgggtcct
tacaagcaaggcaagccagactgtagtataactgtggaagatgacgacctttcctccatg
gcgacgggaaagtcaaaccctcaacagttgtttatgaaggggaagttgaaagtgaaagga
aacatcatgctcactgcaaaattggctcagttgtttaaggataatgccaaaatgtaa

DBGET integrated database retrieval system