KEGG   Pocillopora damicornis (lace coral): 113684511Help
Entry
113684511         CDS       T05773                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00010  Glycolysis / Gluconeogenesis
pdam00053  Ascorbate and aldarate metabolism
pdam00071  Fatty acid degradation
pdam00280  Valine, leucine and isoleucine degradation
pdam00310  Lysine degradation
pdam00330  Arginine and proline metabolism
pdam00340  Histidine metabolism
pdam00380  Tryptophan metabolism
pdam00410  beta-Alanine metabolism
pdam00561  Glycerolipid metabolism
pdam00620  Pyruvate metabolism
pdam01100  Metabolic pathways
Module
pdam_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113684511
   00053 Ascorbate and aldarate metabolism
    113684511
   00620 Pyruvate metabolism
    113684511
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113684511
   00561 Glycerolipid metabolism
    113684511
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    113684511
   00310 Lysine degradation
    113684511
   00330 Arginine and proline metabolism
    113684511
   00340 Histidine metabolism
    113684511
   00380 Tryptophan metabolism
    113684511
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113684511
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     113684511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1350
Motif
Other DBs
NCBI-GeneID: 113684511
NCBI-ProteinID: XP_027057696
LinkDB All DBs
Position
Unknown
AA seq 527 aa AA seqDB search
MAFRLPLRSLSRVVPRRLFAPPASISRSSFATLAERKIDDSPEVKYNQVFINNRFVDSVS
GKTFPTINPATGEKICDVAEGDKADVDIAVKAAKEAFKLGSPWRTMDASERGKLLNRLAD
LLERDQAYLASLETLDNGKPFNDSFNIDLSMTIKCYRYYAGWADKIHGKTIPIDGSFLTY
TRHEPVGIVGQIIPWNFPLLMQAWKLGPALAAGNAIVMKPAEQTPLTALYVASLIAEAGF
PPGVVNMVPGYGPTAGMSIAEHMEIDKVAFTGSTEIGHVIMQAAGRSNLKNVTLELGGKS
PNVVFADSDIDSAVEMSHFALFFNQGQCCCAGSRCFVEEPIYDEFVQRSVERAKSRVVGN
PFDLNTEQGPQVDQEQFSKVMSLIESGNKEGANMVFGGGRHGDKGYFVQPTVFTDVQDHM
RIAKEEIFGPVMQIMKFKDMNELIERANNTIYGLAASVFTKDIDKMNTIAHSIRAGTVWV
NCYDVLDVQAPFGGFKMSGSGRELGEYGLEQYSEVKTITIKLPQKNS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcgtcttcccttgaggtcactttcacgagtcgttccaagaaggctttttgct
cctcctgcttccatcagtcggtcttctttcgcaacgctcgctgagcgtaagattgatgac
agtcctgaagtgaagtacaatcaggttttcatcaacaacaggtttgtggactctgtcagt
ggcaagacattccccacaatcaaccctgcaactggggaaaaaatatgtgatgtggctgag
ggtgacaaggcagatgttgatattgctgttaaggcagccaaagaggcctttaagctaggc
agtccttggagaacaatggatgcatcagaacgtggaaagcttttgaacagactggctgat
ttgcttgaacgagatcaagcttatcttgcaagtttagagactttggacaatggcaagcca
ttcaatgattctttcaatattgatttatccatgacaattaagtgctatcgatactatgct
gggtgggcagacaaaattcatggcaagacaattccaattgatggcagtttcttaacctat
acccgccatgaacctgttggcattgtcggtcaaataatcccatggaacttcccactgctg
atgcaagcctggaaacttggtccagccctggcggctggaaatgcaattgtaatgaaacca
gcagaacagacaccactgactgccttatatgtggcgtctctaattgctgaggctggtttc
ccgccaggtgttgtaaatatggttccaggctacggacctacagcaggaatgtcaatcgct
gaacacatggagattgataaagttgccttcactggctccactgagattgggcatgtaatt
atgcaagcagctggcagaagcaacttgaagaacgtcaccctggaacttggtggcaagagt
cctaacgtggtgtttgctgattccgatatcgacagcgcagtggaaatgagtcactttgct
ctgttcttcaaccagggtcagtgttgctgcgctggcagccgctgtttcgtagaggagccg
atttacgacgagtttgtgcaaagaagtgtggagagggccaaaagccgtgtcgttggaaac
ccttttgatttgaatacagaacaaggaccacaggttgatcaggagcagtttagcaaggtt
atgtccctgatagaaagtggaaacaaggaaggtgccaatatggtctttggaggagggagg
catggtgacaaaggctactttgtgcagcccaccgtctttactgatgtccaagatcacatg
agaattgcaaaggaagagatttttggacccgtgatgcagatcatgaaattcaaggacatg
aacgaattgattgaacgagctaacaataccatttatggtttggctgcctctgtgtttacc
aaggacattgacaagatgaatactattgcccacagcatccgtgctggcactgtttgggtc
aactgttacgatgttctggatgtccaagcgccatttggtggctttaaaatgtctggatca
gggagggaattgggagagtatggtcttgagcaatattcggaggtgaaaacgataacgatc
aagctcccgcagaagaattcttaa

DBGET integrated database retrieval system