KEGG   Clostridioides difficile 630: CDIF630_00122Help
Entry
CDIF630_00122     CDS       T03885                                 

Gene name
tuf1
Definition
(GenBank) elongation factor EFTu / EF1A
  KO
K02358  elongation factor Tu
Organism
pdc  Clostridioides difficile 630
Brite
KEGG Orthology (KO) [BR:pdc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pdc03012]
    CDIF630_00122 (tuf1)
   03029 Mitochondrial biogenesis [BR:pdc03029]
    CDIF630_00122 (tuf1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdc04147]
    CDIF630_00122 (tuf1)
Translation factors [BR:pdc03012]
 Eukaryotic Type
  Elongation factors
   CDIF630_00122 (tuf1)
 Prokaryotic Type
   CDIF630_00122 (tuf1)
Mitochondrial biogenesis [BR:pdc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CDIF630_00122 (tuf1)
Exosome [BR:pdc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CDIF630_00122 (tuf1)
  Exosomal proteins of breast cancer cells
   CDIF630_00122 (tuf1)
  Exosomal proteins of colorectal cancer cells
   CDIF630_00122 (tuf1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AJP09748
UniProt: Q18CE4
LinkDB All DBs
Position
89019..90212
Genome map
AA seq 397 aa AA seqDB search
MAKAKYERTKPHVNIGTIGHVDHGKTTLTAAITKTLYDRYQLGEAVDFANIDKAPEERER
GITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSATDGPMPQTREH
ILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLTEYDFPGDDTPIVRGSALMAL
EDPKSEWGDKIVELFEQIDEYIPAPERDTDKPFLMPVEDVFSITGRGTVATGRVERGVLK
VQDEVELVGLTEAPRKVVVTGVEMFRKLLDQAQAGDNIGALLRGVQRNEIERGQVLAKTG
SVKAHTKFTAEVYVLKKEEGGRHTPFFDGYRPQFYFRTTDVTGACKLPEGIEMVMPGDNV
TMEVDLINSIVVEEGLRFSIREGGRTVASGVVATIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagctaaatacgaaagaacaaaacctcatgttaatatagggacaataggacac
gtagaccacggtaaaactacattaacagcagcaataacaaaaacattatatgacagatat
caattaggagaagcagtagatttcgcaaacatagataaagctccagaagaaagagaaaga
ggaatcacaatatcaacagcacacgttgagtatgaaacaccaaatagacactatgcacac
gttgactgcccaggacatgctgactacgttaagaacatgataacaggagcagcacaaatg
gacggagcaatattagtttgttcagcaacagatggaccaatgccacaaacaagagagcat
atactattatcaagacaagttggagtaccatatatagtagtattcttaaacaaatgtgat
atggtagatgatgaagagttattagagttagtagagatggaagtaagagatttattaaca
gaatatgatttcccaggagatgatactccaatagtaagaggttcagcattaatggcatta
gaagatccaaagagcgagtggggagataagatagtagaattattcgagcaaatagatgag
tatataccagctccagagagagatacagataaaccattcttaatgccagtagaggacgta
ttctcaatcacaggaagaggaacagttgcaacaggaagagtggaaagaggagtactaaaa
gtacaagacgaagtagaattagtaggattaacagaagcaccaagaaaagtagtagtaaca
ggagtagagatgttcagaaaattattagaccaagcacaagcaggggataatataggagca
ttattaagaggagtacaaagaaacgagatagaaagaggacaagtactagcaaagactgga
tcagtaaaggcacacacaaagtttacagcagaagtatatgtacttaaaaaagaagagggt
ggaagacatacaccattctttgatggatatagaccacaattctatttcagaacaacagac
gtaacaggagcttgtaagttaccagaaggaatagagatggtaatgcctggagataacgta
acaatggaagtagacttaataaactcaatagttgtagaagagggattaagattctcaata
agagaaggtggaagaacagtagcttcaggagttgttgctacaataatagagtaa

DBGET integrated database retrieval system