KEGG   Clostridioides difficile 630: CDIF630_02831Help
Entry
CDIF630_02831     CDS       T03885                                 

Gene name
stk
Definition
(GenBank) putative serine / threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pdc  Clostridioides difficile 630
Brite
KEGG Orthology (KO) [BR:pdc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdc01001]
    CDIF630_02831 (stk)
Enzymes [BR:pdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CDIF630_02831 (stk)
Protein kinases [BR:pdc01001]
 Serine/threonine kinases: Other
  Bacterial family
   CDIF630_02831 (stk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo YL1 Kinase-like RIO1 Pkinase_fungal CDC45 Fructosamin_kin VKG_Carbox
Motif
Other DBs
NCBI-ProteinID: AJP12326
UniProt: Q182R7
LinkDB All DBs
Position
complement(2966403..2968412)
Genome map
AA seq 669 aa AA seqDB search
MGDTILGNRYEIIRKIGDGGMAFVYEAKDRLLNRTVALKVLRPEFVDDDEFLTKFKREAE
AVASLSHPNIVNVYDVGEDGKVHYIVMEFVDGKNLKEIIQDEGILDEYTALDITKQIAMA
LSAAHKKGIIHRDIKPHNILISNEGRVVKVADFGIAKAVSNSTMTNIGSIIGSVHYFSPE
QAKGKFVTNNADLYSLGIVLYEMLIGKVPFRGDSPISIALQHINDDIDFTSEEKVRIPQS
VRTTIKKLTEKSSADRYQTAEELIEDIEYIEKNIDLDFIKEYDDFATKKIDEKEINKVVN
PTLAKPAPEKVVKPVEVADLDDDEDYYDDFYEEDDDEEEEEIMRAKKNQRPKSTPSKRTK
KKKKKQESPKSRRRLKVIAAVLILILCAQVFLAYKFLFAGGFGNKSLTVPNLVNMTLEEA
QSAVEKEGLYLSVKSEEYNSEVDENCIISQTPEGGSTNVKKGDTINVVVSKGSSQASVPN
VVGLTLSNAKQLIEENNLKVGTVKYEYSSIYKEGTVLSQSPGAGSSRAQEGDEVNLYVSK
GSEKSNTQTPTVPDKKPTTPENNTPTEPGSNSGNSGGNSGGSNSGNSGGNSGNNGSNSGG
SNSGNSGGNSGGSNSGDNGGSSGGSNSGDNGGSSGGSNSGDNGDSSGGSNSGDNGGTSSG
TGANIGKTE
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
gtgggagatacaattttaggaaatcgatatgaaatcatcaggaagattggtgatggagga
atggcctttgtatatgaggctaaagacagattattaaacaggactgttgcacttaaagta
cttagacctgaatttgtagatgatgatgaatttctaacaaagtttaaaagagaggcagaa
gcagtagcaagtctttcacatccaaatatagtaaatgtttatgatgttggtgaagatgga
aaagttcactacattgtaatggagtttgtagatgggaagaatctaaaagagattatacaa
gatgaaggtatattagatgaatatactgcattagatataacaaaacaaatagctatggca
cttagtgcagcgcacaaaaaggggattatacatagagatataaaacctcataatattctc
atatcaaatgaaggaagagtagtaaaagtggctgattttggtatagccaaagctgtttca
aattcaacaatgactaatattggtagtataataggttcagtgcattatttttcaccagag
caagctaaaggtaaatttgtaactaataatgctgacctgtattctctaggtatagtttta
tatgaaatgttgataggaaaagttccatttaggggagatagtccaatttctatagcactt
caacacattaatgatgatatagactttacatcagaagaaaaagttaggattcctcaaagt
gtaagaactacgataaaaaagcttacagaaaaatctagtgcagatagatatcaaactgct
gaagaattgatagaagatatagagtatatagaaaaaaatattgatttagattttataaaa
gaatatgatgattttgcaactaagaaaattgatgaaaaagaaattaataaagttgtaaat
ccaacacttgcaaaaccagctcctgaaaaagtggttaagcctgttgaagtagctgatttg
gatgatgatgaagattactatgatgatttttatgaagaagatgatgatgaagaagaggaa
gagataatgagagctaaaaagaatcagagacctaagagtactccaagtaagagaactaag
aaaaagaagaaaaaacaggaaagcccaaaatctagaagaagattaaaagtaattgcggct
gttttgatactgatattgtgtgctcaagtattcttagcatataagtttttatttgctgga
gggtttggcaataaatctttgactgttcctaatcttgtaaatatgacattagaagaagct
caaagtgctgttgaaaaagaaggattatacctgagtgtaaaaagtgaagagtataatagt
gaagttgatgaaaattgtataatatcacagacacctgaaggtggaagtacaaatgtcaaa
aagggtgatactataaatgttgtcgtaagtaaaggttcaagtcaggcatctgttcctaat
gtagtgggacttactttgagtaatgcaaaacaacttattgaagaaaataacttaaaagtg
ggaactgttaagtatgaatacagctcaatatataaagaaggtacagttttaagtcagagt
ccgggtgctggctcatcaagagctcaggaaggtgatgaggtaaacctatatgtaagcaaa
ggttcagaaaaatcaaatacacagactccaacagtaccagataaaaaaccaacaacacca
gagaataatacaccaacagaacctggttcaaactcaggaaacagtggtggaaattcagga
ggctcaaattcaggaaatagtggtggaaactcaggcaataatggaagtaactcaggaggt
tcaaactcaggaaatagtggtggaaactcaggaggctcaaactcaggagataatggagga
agttcaggaggctcaaactcaggagacaatggaggaagttcaggaggttcaaactcagga
gacaatggagatagttcaggaggctcaaactcaggagataatggaggaacttcatcagga
actggcgcaaacattggtaaaacagaataa

DBGET integrated database retrieval system