KEGG   Paracoccus denitrificans: Pden_0246Help
Entry
Pden_0246         CDS       T00440                                 

Definition
(GenBank) Xylose isomerase domain protein TIM barrel
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
pde  Paracoccus denitrificans
Pathway
pde00040  Pentose and glucuronate interconversions
pde00051  Fructose and mannose metabolism
pde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pden_0246
   00051 Fructose and mannose metabolism
    Pden_0246
Enzymes [BR:pde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Pden_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABL68360
UniProt: A1AYL6
LinkDB All DBs
Position
1:228259..229149
Genome map
AA seq 296 aa AA seqDB search
MMVRRAASVPGLSHVDLNYPDHVLEEPKVVQAEVNDLGLQVNGLAMRYYTNPALKLGAFT
NPDRAVRQEAIDLTKRGIDAALEMGAPLMTLWLGQDGFDYSFQGDYPRMWEDEIGGIREV
AEHAPDCMISIEYKPNEPRSYALLPDVATTLLAIAETGCGNIGVTLDFAHVLYADEMPAY
AATLIARKSRLLGVHLNDGYAKRDDGLMVGSVHPQATLELLWQITRDGYDGVIYFDTFPD
ASGIDPVEECRTNIETVERFMNMVPRLNADNLLHDAIAGQNSPLSQRAVARIMSGA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatggtccgccgcgccgcaagcgtgccgggtttgagccacgtcgatctcaactatccg
gaccatgtgcttgaagaacccaaggtcgtgcaggcagaggtcaacgatctggggctccag
gtgaacggcctggccatgcgctactacaccaacccggccttaaagctgggcgcctttacc
aaccccgaccgcgcggtgcggcaggaagccatcgacctgaccaagcgcgggatcgacgcg
gcgctggagatgggcgcccccctgatgacgctgtggctaggccaagacggtttcgactac
agttttcagggcgactatccgcgcatgtgggaggacgagatcggcggtatccgcgaggtg
gccgaacacgcacccgactgcatgatctccatcgagtacaagcctaacgaaccgcggtcc
tatgcgctgttgcccgacgtcgccacgaccctgctggcgatcgcggaaaccggatgtggc
aatatcggcgtgacgctggacttcgcccatgtgctttatgccgacgaaatgcccgcctac
gccgccacgctgatcgcgcggaaatcgcggctgctgggcgtgcatctgaacgacggctat
gccaagcgcgacgacgggttgatggtcggcagcgtccatccgcaagccacgctggaattg
ctgtggcagatcacccgcgacggatatgacggcgtaatctatttcgacactttccccgac
gcctcgggcatcgatccggtcgaggaatgccgcaccaatatcgagactgtcgagcgtttc
atgaacatggttccacgcctgaacgccgacaacctgctgcatgacgccattgccgggcag
aactctccgctcagccagcgtgccgtcgcacgcatcatgagcggagcctga

DBGET integrated database retrieval system