KEGG   Paracoccus denitrificans: Pden_2137Help
Entry
Pden_2137         CDS       T00440                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
pde  Paracoccus denitrificans
Pathway
pde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01130  Biosynthesis of antibiotics
pde01230  Biosynthesis of amino acids
Module
pde_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pden_2137
Enzymes [BR:pde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     Pden_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ABL70229
UniProt: A1B3Y5
LinkDB All DBs
Position
1:2138658..2139695
Genome map
AA seq 345 aa AA seqDB search
MSAATDIRPLIGLAATRPLTGTEAEAAFGALFEGAATPAQIGGLLMAMRVRGETVEEMAA
ATRAMRARMNRIKAPEGAMDIVGTGGDGKGTLNISTATAFVVAGAGVPVAKHGNRNLSSK
SGSADALTHLGLNVMSTPEIAEAALAATGICFMMAPVHHPAMRHVGPARAELGTRTIFNL
LGPMTNPGLVKRQLTGTFDRVWNRPMAETLRELGSECAWLVHGGDGTDEISIAEPTWVAQ
LKDGEITEFQISPEDAGLPVHPFEAILGGDPARNAAALRALLDGAQGAYRDAVVLNAAAA
LLIAGQAADLREGAEIARTSIDSGKARAKLAALAAQVGAPADPNG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgccaccgacatccgcccgctgatcggcctggccgccacccgcccgctgacc
ggaaccgaggccgaagccgccttcggcgcgctgttcgagggcgcggccacccccgcccag
atcggcgggctgctgatggcgatgcgcgtgcgcggcgagacggtcgaggagatggccgcc
gccacccgcgccatgcgcgcgcggatgaaccgcatcaaggcccccgagggcgcgatggac
atcgtcggcaccggcggcgacggcaagggcacgctgaacatctcgaccgccacggccttc
gtggtcgcgggcgccggcgtgccggtcgccaagcacggcaaccgcaacctgtcctccaag
tcgggctcggccgatgcgctgacccatctggggctgaacgtgatgtccacgcccgagatc
gcggaggccgcgctggccgcgaccggcatctgcttcatgatggcgccggtgcatcacccc
gccatgcgccatgtcggcccggcgcgggcggaactgggcacccgcaccatcttcaacctg
ctggggccgatgaccaatcccggcctggtcaagcggcagttgaccggcaccttcgaccgg
gtctggaaccgcccgatggccgagacgctgcgcgagctgggctcggaatgcgcctggctg
gtgcatggcggcgacggcaccgacgagatctcgatcgccgagccgacctgggtggcacag
ctcaaggacggcgagatcaccgagttccagatctcgcccgaggatgccggcctgcccgtc
catccgttcgaggcgatcctgggcggcgatccggcccggaacgccgcggcgctgcgggcg
ctgctggacggcgcgcagggggcctatcgcgacgcggtggtgctgaacgccgctgccgcg
ctgctgatcgcgggccaggcggccgacctgcgcgaaggcgccgagatcgcccgcacctcc
atcgacagcggcaaggccagggccaagcttgccgcgctggccgcccaggtcggcgcgccg
gcggaccccaatggctga

DBGET integrated database retrieval system