KEGG   Paracoccus denitrificans: Pden_2142Help
Entry
Pden_2142         CDS       T00440                                 

Definition
(GenBank) SOS-response transcriptional repressor, LexA
  KO
K01356  repressor LexA [EC:3.4.21.88]
Organism
pde  Paracoccus denitrificans
Brite
KEGG Orthology (KO) [BR:pde00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pde01002]
    Pden_2142
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pde03400]
    Pden_2142
Enzymes [BR:pde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     Pden_2142
Peptidases and inhibitors [BR:pde01002]
 Serine peptidases
  Family S24: LexA family
   Pden_2142
DNA repair and recombination proteins [BR:pde03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Pden_2142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LexA_DNA_bind Peptidase_S24 MarR_2 HTH_IclR MarR DnaJ_C Pox_F16
Motif
Other DBs
NCBI-ProteinID: ABL70234
UniProt: A1B3Z0
LinkDB All DBs
Position
1:2142920..2143618
Genome map
AA seq 232 aa AA seqDB search
MLTRKQIQLLEFIQARMARDGVPPSFDEMKLALDLRSKSGIHRLVTALEERGFIRRLPHR
ARALEIVRLPESLSKGPGFQPRVIEGTMPDRPAPLPRGAMEVSVSAIELPVMGRIAAGVP
IEAISEISHHIAVPTTMLSGQDRHYALEVRGDSMIEAGINDGDVVVIREQNAAESGDIVV
ALVDGYEATLKRYRRKGNMIALEAANPAYETRVLPEDKVRIQGRLVGLIRSY
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccaggaaacagatccagcttcttgaattcattcaggcgcgaatggcccgcgac
ggggtgccaccctcgttcgacgaaatgaaactcgcgctggacctgcgctcgaaatcggga
attcaccgcctcgtgaccgcccttgaggaacgcgggttcatccgccgcctgccgcatcgc
gcccgtgcgctggaaatcgtccgcctgcccgaaagcctcagcaagggcccgggcttccag
ccccgcgtgatcgagggaaccatgcccgaccgccccgccccgctgccgcgcggcgcgatg
gaggtttccgtctcggccatcgaactgccggtgatgggccgcatcgccgcaggcgtcccg
atcgaggcgatctcggaaatctcgcatcacatcgccgtgccgaccacgatgctctccggc
caggaccgccattacgcgctggaggtgcgcggcgattcgatgatcgaggccgggatcaac
gacggcgacgtggtggtgatccgcgaacagaacgcggccgagagcggcgacatcgtcgtc
gctctggtcgatggctacgaggccacactgaaacgctatcggcgcaagggcaacatgatt
gcactggaagcggccaaccccgcctatgagacccgcgtcctgcccgaggataaggtccgc
atccagggccggctagtggggctgatccgcagctactag

DBGET integrated database retrieval system