KEGG   Paracoccus denitrificans: Pden_2338Help
Entry
Pden_2338         CDS       T00440                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pde  Paracoccus denitrificans
Pathway
pde00250  Alanine, aspartate and glutamate metabolism
pde00410  beta-Alanine metabolism
pde00640  Propanoate metabolism
pde00650  Butanoate metabolism
pde01100  Metabolic pathways
pde01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pden_2338
   00650 Butanoate metabolism
    Pden_2338
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pden_2338
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pden_2338
Enzymes [BR:pde01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Pden_2338
Amino acid related enzymes [BR:pde01007]
 Aminotransferase (transaminase)
  Class III
   Pden_2338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABL70429
UniProt: A1B4I5
LinkDB All DBs
Position
1:2334887..2336155
Genome map
AA seq 422 aa AA seqDB search
MTSLTDRKNAAISRGVGMTTQIYAERAENAEIWDKDGNRYIDFAAGIAVVNTGHRHPRVV
EAVKAQLDRFTHTCHQVVPYENYVALAERLNRLVPGNGPKKTAFYTTGAEAVENAVKIAR
HHTGRAGIIAFAGGFHGRTFLGMSLTGKVQPYKAGFGPMMNDIWHLPFPNALHGVTADEA
LAALDRLFKADIDPSRVAAIIVEPVQGEGGFYEAPPGFMQRLRQICDQYSILLIADEVQT
GFARTGKLFAMEHHGVAADLTTMAKGLGGGLPISAVTGRADVMDSPAPGGLGGTYAGNPL
AVAAAHAVLDVIEDEGLCERATRLGQRLKQRLAGIAETVPEIVDIRGPGFMNAVEFNTAG
SDKPSADFANRVREEALKRNLILLTCGVHGNVIRFLAPLTIQDTVFDEALDILEDSIQAA
RN
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctgaccgaccgcaagaacgccgccatctcgcgcggcgtcggcatgaccacg
cagatctatgccgaacgcgccgagaatgccgagatctgggacaaggatggcaaccgctat
atcgacttcgccgccggcatcgccgtggtcaataccggccaccgccatccgcgcgtcgtc
gaggcagtcaaggcgcagctcgaccgcttcacccatacctgccaccaggtcgtgccctat
gagaactacgtcgcgctggccgaacggctgaaccggctcgtccccggcaacggcccgaaa
aagaccgccttctacaccaccggcgccgaggcggtcgagaacgcggtcaagatcgcccgc
caccataccggccgcgccggcatcatcgcctttgccggcggctttcacggccgcaccttc
ctgggcatgtcgctgaccggcaaggtccagccctacaaggccgggttcgggccgatgatg
aacgacatctggcacctgcccttccccaacgcattgcacggcgtgacggcggacgaggcg
ctggccgcactcgaccggctgttcaaggccgatatcgacccctcgcgcgtcgccgccatc
atcgtcgagccggtgcagggcgagggcggcttctacgaggcgccgccgggcttcatgcag
cgcctgcgccagatctgcgaccagtattccatcctgctgatcgccgacgaggtgcagacc
ggctttgcccgcaccggcaagctgttcgccatggagcatcacggcgtggcggccgacctg
accaccatggccaaggggctgggcggcgggctgccgatcagtgccgtcaccggccgcgcc
gatgtcatggacagccccgcacccgggggactgggcggcacctatgccggcaatccgctg
gccgtcgccgctgcccatgccgttctggacgtgatcgaggacgaagggctttgcgaacgc
gccacccgcctcggccagcggctgaagcagcgcctggccggcatcgccgaaactgttccc
gagatcgtcgacatccgcggccccggcttcatgaacgcggtcgagttcaacaccgccggc
agcgacaagcccagcgccgatttcgccaaccgcgtgcgggaagaggcgctcaagcgcaac
ctgatcctgctgacctgcggcgtccacggcaacgtgatccgcttcctcgcgccgctgacc
atccaggacacggtcttcgacgaggcgctcgacatcctcgaggactcgatccaggccgcc
cgcaactga

DBGET integrated database retrieval system