KEGG   Clostridioides difficile 630Derm: CD630DERM_00380Help
Entry
CD630DERM_00380   CDS       T03785                                 

Gene name
acoC
Definition
(GenBank) Acetoin dehydrogenase E2 component(dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pdf  Clostridioides difficile 630Derm
Pathway
pdf00010  Glycolysis / Gluconeogenesis
pdf00020  Citrate cycle (TCA cycle)
pdf00620  Pyruvate metabolism
pdf01100  Metabolic pathways
pdf01110  Biosynthesis of secondary metabolites
pdf01120  Microbial metabolism in diverse environments
pdf01130  Biosynthesis of antibiotics
pdf01200  Carbon metabolism
Module
pdf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630DERM_00380 (acoC)
   00020 Citrate cycle (TCA cycle)
    CD630DERM_00380 (acoC)
   00620 Pyruvate metabolism
    CD630DERM_00380 (acoC)
Enzymes [BR:pdf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CD630DERM_00380 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding AATase CAT
Motif
Other DBs
NCBI-ProteinID: CEJ96540
LinkDB All DBs
Position
1:65741..66787
Genome map
AA seq 348 aa AA seqDB search
MVANKIKATPAARSQARKDNIKLDRLIGSGENGRIHLVDVLNYLKDNKANTTPLARRIAE
DLNIDLETIVGTGYNGKIRKCDVEKLTAKETIVSTNTSKSSEKKELKIENENSSMFNTVE
GIFEKPNPMRATVAKRMSESYFSAPVFTFNIEVDATELKVLRAKLIDTVKESTGVKLTMT
DLIVMAVSKILPNHQALNSAWTDEGIFRYKDVNIAIAVGLDEGLYVPVVKNANKKSLKEI
AKESKELAEKVKTGKLMPADQEGNTFTISNVGMYGITTFTPIINMPSSAILGVGATQDKF
VPVNGEAKIKPIMNLSLTSDHRVIDGTVAAKFLKDLKELLENPLSMLV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtggcaaataaaataaaagccacaccagcagctagaagtcaggcaagaaaagacaat
ataaaattagataggctgattggaagtggagaaaatggaaggattcatttagtagatgtg
ttaaattatttaaaagataataaagcaaatactactcctttagctagaagaatagcagaa
gatttaaatatagatttagaaactattgtaggtactggatataatggaaagataagaaag
tgtgatgtggaaaaattaactgcaaaagaaactattgtatcaactaatacatctaaatct
agtgagaaaaaagagctgaaaattgaaaatgaaaattcaagcatgtttaacacagtagaa
ggaatatttgaaaagccaaatccaatgagagctactgtagcaaaacgaatgtcagaaagt
tattttagtgctcctgtatttacattcaatatagaagtagatgctacagaattgaaggta
cttagagcaaagttaatcgacacagtaaaagaatcaactggagtaaaattaactatgaca
gatttaatagtaatggcagtatctaaaatacttccaaatcatcaagccttaaattcagca
tggacagatgagggtatatttagatataaagatgtaaatatagctattgcagttggttta
gatgaaggcttatatgttccggtagtaaaaaatgcaaacaaaaagtctttaaaagaaata
gcaaaagaaagcaaagaacttgcggaaaaagtaaagacagggaaacttatgccagcagac
caagaaggtaatacatttacaataagtaatgttggaatgtatggtataactacatttaca
cctataataaatatgccttcaagtgcaatcttaggggtaggtgctacacaagataagttt
gttccagtaaatggagaggctaaaataaaacctataatgaacttatcattaacatcagac
catagagtaatagatggaacagtagctgcaaaattcttaaaagatttaaaagaattgtta
gaaaatcctttatcaatgcttgtatag

DBGET integrated database retrieval system