KEGG   Clostridioides difficile 630Derm: CD630DERM_14080Help
Entry
CD630DERM_14080   CDS       T03785                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase (D-alanylalaninesynthetase) (D-Ala-D-Ala ligase)
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pdf  Clostridioides difficile 630Derm
Pathway
pdf00473  D-Alanine metabolism
pdf00550  Peptidoglycan biosynthesis
pdf01100  Metabolic pathways
pdf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pdf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CD630DERM_14080 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CD630DERM_14080 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CD630DERM_14080 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pdf01011]
    CD630DERM_14080 (ddl)
Enzymes [BR:pdf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CD630DERM_14080 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:pdf01011]
 Precursor biosynthesis
  Amino acid ligase
   CD630DERM_14080 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: CEJ97994
LinkDB All DBs
Position
1:complement(1637455..1638354)
Genome map
AA seq 299 aa AA seqDB search
MKIAVIMGGISSEREVSLNSGKEIYNNLDKNKYEVVKVIIDDKKDIFTKIPEDIDFAILA
LHGKFGEDGCIQSILETMDIPYSGCGPLCSGMCMDKNITKKMLRDSNLPTAPWVLVKSVD
EIDYDEIDNIGYPVFIKPNSGGSSVATFFIHSKDEVEEAVRKGLEVDEFVMIEKYIPGGE
YTSFILNGEVFPTISIKSDSGFFDYEAKYSVEKGAKEEVVYLDEELQKRVNEISETCWKI
FNCKAYVRVDMIISEGIPYVLELNTLPGMTQTSLIPRSAAARGIKYSELLDKLIEYSLN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcagttataatgggtggaatatcatcagagagagaagtttctttaaattca
ggaaaagagatatataataaccttgataaaaataaatatgaagttgtaaaagtaataata
gatgataaaaaagatatatttacaaagataccagaagatatagattttgcaatacttgct
ttacatggaaaatttggtgaagatggatgtatacaatcaatacttgagactatggatata
ccatactctggatgtggacctctttgcagtgggatgtgtatggataaaaatataactaaa
aaaatgcttagagattcaaacctacctactgctccatgggttttagtaaaatcagttgat
gaaatagactatgatgaaatagataatataggttatccagtatttataaaaccaaactca
ggaggttcaagtgtagccacattctttattcattctaaggatgaagttgaagaagcagtt
agaaaaggtctggaagttgatgaatttgtaatgattgaaaaatatataccaggtggagaa
tatacttcattcatattaaatggagaagtgttccctacaatatctataaaatctgattca
ggattctttgattatgaagctaaatactcagttgaaaaaggtgcaaaggaagaagttgtt
tacttagatgaagaacttcaaaaaagagtaaacgaaatttctgagacttgttggaaaatt
tttaattgcaaagcatatgtaagagttgatatgattataagtgaaggtattccatatgtt
cttgaactaaatactcttcctggaatgactcaaactagtttaattcctagaagtgctgct
gctagaggtattaagtacagtgaactattagataaacttatagaatactctttaaattag

DBGET integrated database retrieval system