KEGG   Planococcus donghaensis: BCM40_00405Help
Entry
BCM40_00405       CDS       T04451                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pdg  Planococcus donghaensis
Brite
KEGG Orthology (KO) [BR:pdg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCM40_00405
Enzymes [BR:pdg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BCM40_00405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored Thi4 DAO FAD_binding_3 FAD_binding_2 AlaDh_PNT_C NAD_binding_8 K_oxygenase Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: ANU21884
UniProt: A0A1C7ED40
LinkDB All DBs
Position
3237546..3239093
Genome map
AA seq 515 aa AA seqDB search
MILDSAIKAQLEQYLQLLENDVLLKVSASTDKVSRNMTALLEEISAMSSLITLEYAQLER
TPSFSVNRPGQDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVEQNVIDQIQSIQGSYHF
DSYISLSCQNCPEVVQGLNLMSILNPNITHTMIDGAVYKAEVESKDIMAVPTVFLNGESF
GSGRMTLEELLAKLGSAPDASEFANKDPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTLSIENFISVKKTDGPKFAASLEEHVKEYDIDVMNLQRAKKLEKKELFELELE
NGAVLKGKTIILSTGARWRNIGVPGEEEFKNKGVAYCPHCDGPLFAGKDVAVIGGGNSGV
EAAIDLAGVVNHVTVLEYNSELKADSVLQDRLRSLPNATIITNARTQEITGTEKVNGISY
LDLQTGNLNHIELAGVFVQIGLVPNTDWLGDLVERTQHGEIVIDQRGATNVPGVFGAGDC
TNIPYKQIIISMGSGATASLSAFDHLIRSKVPVLV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgatattagattccgcaataaaagctcaattagaacagtatctacaattgcttgaaaat
gatgtgttgttgaaagttagcgcaagcactgataaagtttctcgcaacatgacggcattg
ctggaagaaatatctgcaatgtcttctctcattactctagagtatgcacagcttgaaaga
acaccaagctttagcgttaaccgtccaggacaagacaccggtgttgtatttgctggtatt
cctttaggacatgagtttacgtctcttgtgcttgcattgttgcaagtgagcggacgtgcg
ccaaaagttgagcaaaacgtaatcgatcaaattcaaagcattcaaggttcttaccacttt
gactcatatattagcttgagttgtcaaaactgccctgaagtggttcaaggactcaactta
atgagtattctcaacccaaatatcacacatacaatgattgatggcgcggtatacaaagca
gaagttgaaagcaaagacattatggcggtaccgactgtcttcttaaacggggaatcgttt
ggtagcggacgcatgacacttgaagaactgttagctaaacttggcagcgcgccagatgca
tccgaatttgcaaacaaagatccatttgatgtacttgttgtcggtggcggaccggctgga
gctagtgctgccatttacgcagcacgcaaaggcatacggaccggcattgttgcggaacgc
tttggcggtcaagtcatggatacgttgagcatcgaaaacttcattagtgtgaaaaagaca
gatggcccgaaatttgcggccagtcttgaagagcatgtgaaggaatacgatatcgacgtt
atgaacttgcaacgcgcgaaaaagttggagaaaaaagaacttttcgagcttgaacttgaa
aatggtgctgtcttaaaaggcaaaacgatcattctttcaacaggtgcacgctggcgcaac
attggcgtgccaggtgaagaagagtttaagaacaaaggtgtcgcttactgtccacattgc
gatggtccattgtttgcgggcaaagacgtagcggttatcggcggcgggaactccggcgtc
gaagcagcaatcgatctagcaggtgttgtaaatcacgtgactgttctggagtacaactcc
gaactcaaagccgattctgttttacaagatcgactacgtagcttacccaatgcaacaatc
atcacaaatgctcgaacacaagaaattaccggcacagaaaaagtaaacggcatttcttat
ctcgaccttcaaaccggaaaccttaaccatatcgaattagctggtgtctttgtgcaaatc
ggccttgttccgaacacagactggctaggtgatttggtagaacgcacacagcatggcgaa
atcgtcattgaccaacgtggagctaccaacgttccaggtgtgtttggtgcaggagactgt
accaacattccttataaacaaatcatcatttcaatgggatctggtgcaactgcctcactg
agtgcttttgaccatcttattagaagtaaagttcctgtcttggtttaa

DBGET integrated database retrieval system