KEGG   Planococcus donghaensis: BCM40_10295Help
Entry
BCM40_10295       CDS       T04451                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pdg  Planococcus donghaensis
Pathway
pdg00361  Chlorocyclohexane and chlorobenzene degradation
pdg00625  Chloroalkane and chloroalkene degradation
pdg01100  Metabolic pathways
pdg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCM40_10295
   00361 Chlorocyclohexane and chlorobenzene degradation
    BCM40_10295
Enzymes [BR:pdg01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BCM40_10295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: ANU23749
UniProt: A0A1C7EIV5
LinkDB All DBs
Position
1178358..1179023
Genome map
AA seq 221 aa AA seqDB search
MENSIKAFVFDVYGTLFDVTAIKKECEELYPGYGEKISQTWRSKQVEYFMLRQLMGNYAT
LYAITHDALKYALNENDLQASKENEQKLLDAYLHLPLYSESKEVLTQLKDKNLVVFSNGS
HDMLDPLVKNAGLEELFDQVLSIDDVKQFKPTPASYQYALEQLGIESHEVLFMSSNGWDV
SGAKSFGFQTAWINRKGMPVEELDLEPDYIFDDLTGLLKWK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtggagaattcaatcaaagcttttgtgttcgatgtttacggaaccttgttcgatgttacg
gcgataaaaaaagaatgtgaggaattatatcctggatacggtgagaagatcagtcagact
tggagatctaagcaagttgaatactttatgttgcgccagttgatgggcaattatgccacg
ctttatgccattacacatgatgcattaaaatatgcactaaatgaaaatgacttgcaggca
agtaaagaaaacgagcaaaagttattggatgcctatctgcatttaccgctttactcagaa
tcgaaagaagttcttacgcagttaaaggataaaaacttagtggttttttcaaatggctct
cacgatatgctggatccattagttaaaaatgctggtttagaagagttgtttgatcaagtg
ctgagtattgacgacgtgaagcaatttaaaccaacaccggcatcttatcaatatgcatta
gaacaacttggaatcgaaagccatgaagttcttttcatgtcgtctaacggctgggatgta
tcgggggcgaaaagtttcggattccaaacagcttggatcaaccgaaaaggaatgccagtt
gaagagctcgacctagagccggattatatatttgatgatttaactggattgttaaagtgg
aagtaa

DBGET integrated database retrieval system