KEGG   Paenibacillus donghaensis: B9T62_14510Help
Entry
B9T62_14510       CDS       T04971                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pdh  Paenibacillus donghaensis
Pathway
pdh00010  Glycolysis / Gluconeogenesis
pdh00020  Citrate cycle (TCA cycle)
pdh00620  Pyruvate metabolism
pdh01100  Metabolic pathways
pdh01110  Biosynthesis of secondary metabolites
pdh01120  Microbial metabolism in diverse environments
pdh01130  Biosynthesis of antibiotics
pdh01200  Carbon metabolism
Module
pdh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pdh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B9T62_14510
   00020 Citrate cycle (TCA cycle)
    B9T62_14510
   00620 Pyruvate metabolism
    B9T62_14510
Enzymes [BR:pdh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B9T62_14510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA Transferase ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: ASA21881
UniProt: A0A2Z2KNZ0
LinkDB All DBs
Position
complement(3323982..3325313)
Genome map
AA seq 443 aa AA seqDB search
MAKFEYRFPELGEGLHEGEIIKMHIKAGDKVTDDDIVMEVQNDKAVVEVPCPVNGTVLEV
FTKDGQVCRVGEVVAIIDAEGDVPEQEAPAGDHGSQEADAAKGSADTTSSPAATSPADAK
EGGAAPSADAVPAPDRDVLATPGVRKFARDNSVDISKVTGSGKNGKITQEDVEAFLNGGG
SAAPAAPAAEAPKSEAKAAAPAAASSGNVSMEEERVPFKGIRKAISNAMVKSAYTAPHVT
IMDEVDVTELVAFRARMKPVAEKKGVKVTYLPFIVKALVAASRQFPALNAMIDEESNEIV
YKKYYNIGIATDTANGLIVPVIKDADRKSIWMIASSISDLALRGRDGKLAPNEMKGSTIS
ISNIGSAGGMFFTPIINFPEVAILGTGRITEKPVVKNGEIVAAPVMALSLSFDHRIIDGA
TAQNFMNYIKTLLANPDMLVMEV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaatttgagtaccggttcccggaactgggcgaaggcttgcatgaaggtgaaatt
atcaaaatgcatattaaagccggagataaagttacagacgacgatatcgtgatggaggtt
cagaacgataaagccgtagtagaggtaccttgtccggttaacggcaccgtgctggaagta
ttcacgaaagatggacaggtatgccgtgttggcgaggttgtagccatcattgatgccgaa
ggcgatgttcctgaacaagaagcaccagccggtgaccatggctcccaggaagcagacgct
gccaaaggtagcgcagacacaacttcttctcctgcagctaccagccctgccgatgccaaa
gaaggcggagcagcacctagtgcagatgctgtcccagcacctgaccgtgatgttctggct
acgcctggcgtgcgcaagttcgcccgtgataacagtgtagacatttccaaagtgaccgga
tccggcaagaacggcaagatcacccaggaagatgtggaagcattcctgaacggtggcggt
tccgcagcaccggctgctcctgcagcagaagctcctaaatcggaagccaaggcagcagca
ccggcagcagcttcttccggcaatgtaagcatggaagaagaacgcgtaccatttaagggt
atccgcaaagcgatctccaatgcgatggttaagtcggcttacaccgcaccacacgtaacc
attatggacgaagtggacgttaccgagctggtagctttccgtgcccgtatgaagcctgta
gccgagaaaaaaggcgtgaaagtaacatacctgccgtttattgttaaggctctggttgcg
gcttcccgtcaattccctgcgcttaatgcgatgattgacgaagagtccaatgagattgtt
tacaagaaatactacaacatcggtatcgcaacagatacagccaacggcttgatcgttcct
gtaatcaaggatgccgaccgcaagagcatctggatgattgccagcagcattagcgatctg
gctctgcgtggacgcgacggcaaactggctccgaacgaaatgaaaggcagcacaatctcg
atcagcaacatcggctctgccggcggtatgttcttcactccgattatcaacttccctgaa
gttgcaatcctgggaactggccgtattactgagaaacctgttgtcaagaacggcgaaatc
gtggctgcaccagtaatggcgctatccctgagtttcgaccaccgtattattgatggcgca
acagcgcagaacttcatgaactacatcaaaacgctgcttgctaatcctgacatgttagta
atggaggtgtaa

DBGET integrated database retrieval system