KEGG   Paenibacillus donghaensis: B9T62_28185Help
Entry
B9T62_28185       CDS       T04971                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pdh  Paenibacillus donghaensis
Pathway
pdh00620  Pyruvate metabolism
pdh00680  Methane metabolism
pdh01100  Metabolic pathways
pdh01120  Microbial metabolism in diverse environments
pdh01200  Carbon metabolism
Module
pdh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pdh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B9T62_28185
  09102 Energy metabolism
   00680 Methane metabolism
    B9T62_28185
Enzymes [BR:pdh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B9T62_28185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 OTCace Enkurin
Motif
Other DBs
NCBI-ProteinID: ASA24302
LinkDB All DBs
Position
complement(6222285..6225077)
Genome map
AA seq 930 aa AA seqDB search
MTELTTTVSKSNSNNLLRRDVRFLGNILGEVLVHQGGNELLEIVEKIRETSKSLRSLFLP
ELHTEFKELITSLDPENRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGETVQPGSI
ESAIQELRERDFSQDDVREIIKGMSLELVMTAHPTEAMRRAILDIHKRIADDVTGLDNPT
LTFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETIFHVLPDVYQELE
RCLSKYYPGQNWHVPTYLRFGSWIGGDRDGNPSVTSAVTLETLRMQRKLAIREYQRIMRE
LMQYLSFSTSIVSVTQELLDSIEQDRNIINLDKGKTWHNDNEPYRIKLSYMIGKTQNVLD
DETKGTPERYSSPEEFIDDLNVIDRSLRHHYADYVADTYIKKLIRQVELFGFHTATLDVR
QHSQEHENAMTEVLEKMNVTPDYSKLSEDEKVDLLEKLLNDPRPLTSPYQSYSESTEECL
SVYRTVFQAQEEYGQQCITSYLISMAEAASDILEVMVFSKEVGLFRKDNDGTVVCTLQAV
PLFETIDDLHEAPQIMHRLLSLPIYRDAVRAMHDLQEIMLGYSDSNKDGGVVTANWELRV
ALKQITATADEFGIKLKFFHGRGGALGRGGMPLNRSILAQPASTIGGGIKITEQGEVISS
RYSMQGIAYRSLEQATSALVTAAINARTPQADLYEEKWDEIIKNISDVSLNKYQDLIFRD
PDFLTYFKESTPLPEVGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSFYQGKEENLKIMQHMYENFSFFTTLIDTLQMAIAKADLIIAKEYAGMGKNDEARE
RIFGQIEEEFKLTSELILKITRQQDILDNVPVIQESIRLRNPYVDPLSYLQVQLLAELRE
LRDADGDDPELLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacttacgactaccgtcagcaaaagcaactctaacaatctgctgcggcgggac
gtacggttcttggggaatatactgggcgaggtcttggttcaccaaggcggcaacgagctg
ttggagattgtggagaaaatccgcgagaccagcaaatcgctgcgctcattgtttttgcct
gaactgcacactgaatttaaggaattgatcacttctctggatccggagaaccgccaccag
gtgatacgggcattcgccatatatttccaattggtgaatattgctgagcaaaaccaccgg
attcgccgcaaacgtgattacgagcgttctgccggggaaacggtacagccagggtccatc
gaaagcgccattcaagagctgcgggagcgtgatttctcccaggatgatgtgcgtgagatc
atcaaagggatgtcgctggagctggttatgacggctcacccaacagaggccatgcgccgt
gccatcctcgacatccataaacggattgccgacgatgtgacggggttggacaatcctacc
ctaactttccgcgaacgtgaacaactgcgtgagaagctgctgaacgaagtgattacactg
tggcagaccgatgagctgcgtgaccgcaagcccacagtgctcgatgaagtgcgcaacggg
atgtattatttccatgagacgatctttcatgtgctgcctgatgtctaccaggagcttgaa
cgctgcctgagcaaatattatccggggcagaactggcatgtgcctacctatctgcggttt
ggatcgtggatcggcggcgaccgtgacggcaacccttcggtaacctctgcggttacgctg
gaaacgctgcgcatgcagcgcaagctggccattcgggaatatcagcggattatgcgcgag
ctgatgcaatatttgagcttcagtacaagcattgtcagcgtaacccaggaactgctggat
tccattgagcaggaccgcaatattatcaacctcgacaaaggcaagacctggcacaacgat
aatgaaccttaccggattaagctgagttacatgatcgggaagacacagaatgtcctcgat
gatgaaaccaagggtacaccggagcgttattcctcaccagaggaatttatagatgatctg
aacgtcattgaccgcagccttcggcatcattatgccgattatgtagcggatacctacatt
aagaagctgatccgccaggtggagctgttcggcttccacacggcaactcttgatgtgcgc
cagcacagccaggagcatgagaatgcgatgactgaggttctggagaagatgaatgtaacg
ccggattactccaagctctcggaggacgagaaggtggatctgctggagaagctgctgaat
gatccgcgtccgctgacttcgccttaccaatcgtattccgaaagcacggaagaatgcctc
agcgtataccgcacggtattccaggctcaggaagagtatggccagcagtgtattaccagc
tatctgatcagtatggcggaagcggccagtgatatcctggaagtgatggtgttctccaag
gaagttggcttgttccgcaaggacaatgatgggaccgtagtctgcacactgcaggcggtg
ccgctcttcgagaccattgatgacctgcatgaagcaccgcagattatgcacagactgctt
agcctgccgatctaccgcgatgcggtcagagccatgcatgatcttcaggagatcatgctt
ggttattctgacagcaacaaggacggcggcgtggttaccgcgaactgggagcttcgcgtg
gcactgaagcagattacagctacagccgatgaattcggcatcaagctgaagttcttccat
ggccgcggtggggcactgggccgcggcggcatgccgctgaaccgcagtatcctggctcag
ccagcttcgacgattggcggcgggatcaagattacggagcagggtgaggttatctcctcc
cgttactccatgcagggcattgcttaccgcagtctggaacaggctacatcggcgctggtg
acagcagcgattaatgccagaactccacaggcggatctgtatgaggagaagtgggatgag
attatcaagaacatctccgatgtatccttgaacaaatatcaggatctgatcttccgtgat
cccgatttcctgacctatttcaaagaatccacgccgctgcctgaagtcggagagctgaac
atcggttcccgtccttccaagcgcaagaacagcgaccgcttcgaagacctgcgtgcgatt
ccttgggtatttgcctggacacagagccgttatctgctcccggcctggtacgctgcaggc
accggactgcagagcttctatcagggcaaggaagagaacctgaagatcatgcagcatatg
tatgagaacttctcgttcttcaccacgctgattgatacgctgcagatggcgatcgccaag
gcggatttgattatcgccaaggaatacgccggcatgggcaaaaatgacgaggcgcgcgag
cggatcttcggccagattgaagaggagttcaaactaacctccgagctgatcctgaagatt
acccgccagcaggatattctggacaacgtaccggtgatccaggaatccatccgtctgcgc
aatccttatgtcgatccactcagctatctgcaggtgcagctgctcgctgagctgagagag
ctgcgcgacgccgacggtgatgatcccgagctgctccgcgaggtgctgctcacgatcaac
ggcattgccgcagggctgcggaatacgggctga

DBGET integrated database retrieval system