KEGG   Paenibacillus donghaensis: B9T62_31180Help
Entry
B9T62_31180       CDS       T04971                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pdh  Paenibacillus donghaensis
Brite
KEGG Orthology (KO) [BR:pdh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B9T62_31180
Enzymes [BR:pdh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     B9T62_31180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored FAD_binding_3 Thi4 AlaDh_PNT_C DAO K_oxygenase NAD_binding_8 Thioredoxin_4 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ASA24833
UniProt: A0A2Z2KMU5
LinkDB All DBs
Position
6854654..6856183
Genome map
AA seq 509 aa AA seqDB search
MILDADIKVQLNQYLQLMEGNVLLKVSVGTDDVSNEVLALVDELAAMSSSITVEKTSLPR
TPSFSVNRIGEDTGITFAGVPLGHEFTSLVLALLQVSGRAPKVEQNVIDQIRNIKGEYHF
ETYISLSCHNCPDVVQALNLMSVLNSGITHTMIDGAAFKEEVERKDIMAVPSVYLNGEFL
SSGRMTLEEILAKISDAPDASELTNKEPYDVLVVGGGPAGASASIYAARKGIRTGIVAER
FGGQVMDTMGIENFISVKHTEGPKLVASLEEHVKEYGIDVMNLQRAKRLEKKEFIEIELE
NGAVLKSKTVILSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFAGKHVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADAVLQKRLYSLPNVTVIKNVQTKEITGTDKVNGISY
VERDTEAVQHIELQGVFVQIGLVPNTDWLGDVIERTRFGEIVVDGHGATNIPGVFAAGDC
TNSAYKQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcagatataaaggtacaactgaatcaataccttcaacttatggaagga
aatgtgctgctcaaggttagtgtaggaaccgatgatgtatctaatgaagtcctagctcta
gtggatgaattagccgctatgtcctctagcattactgttgagaaaacaagcctaccaaga
acaccaagttttagtgtgaatcgtatcggcgaagatactgggataacttttgctggtgtc
cctttgggacacgaattcacttcattagtgctagctctactgcaggtaagtggaagagct
ccaaaagttgagcaaaacgtaatcgatcagattcgaaacattaaaggcgagtatcatttt
gaaacttacatcagtctcagttgccacaattgtcccgatgtagttcaagccctaaacttg
atgagtgttctcaattccgggattacccatactatgattgacggcgcagcattcaaagaa
gaagtagaacgtaaagacatcatggccgtgccttctgtttacctgaatggtgaattctta
agcagtggtcgcatgacacttgaagaaattctcgccaagatcagtgatgctccggatgca
tcagagcttactaataaagaaccctatgacgtgctcgttgttggaggcggcccagctggc
gcaagtgcatcgatctatgcggcgcgtaaaggcattcgtacaggcattgttgctgaacgt
tttgggggccaggtcatggacactatgggcattgagaactttatcagtgtgaagcatacg
gaaggtcccaagcttgtagccagtctggaagagcatgtcaaagagtatggcattgatgtg
atgaatttacagcgtgccaaacgtttagagaagaaggaatttatcgaaatcgagcttgaa
aatggtgccgtgctgaagagcaaaaccgtcatcctatcaacaggtgcccgttggcgcaat
gtgggtgtacctggcgaagcagagtttaagaataaaggtgttgcatactgtcctcattgt
gacggtccattgtttgcaggaaaacacgtagccgttattggcggcggtaattccggcatt
gaagcagcgattgatctcgcaggcattgtgaagcatgtaacggtgcttgaatttatgccg
gagctgaaagctgatgctgtgctacaaaaacgtctttacagtctacctaatgtaacggta
ataaagaacgttcaaaccaaagaaattacaggcaccgacaaggtaaacggtattagctac
gttgaacgtgatacagaagcagtgcaacatattgagttgcagggtgtgtttgtccagatc
ggtcttgtgcccaatacggattggttaggcgatgtcattgaacgtactcgcttcggtgag
atcgttgtagatggccatggcgctacgaatataccaggagtatttgccgcaggcgactgt
accaatagtgcctataaacagatcattatttccatgggctcgggtgcgaccgctgctcta
ggggcattcgattatctcatccgcaattga

DBGET integrated database retrieval system