KEGG   Parabacteroides distasonis: BDI_0271Help
Entry
BDI_0271          CDS       T00549                                 

Definition
(GenBank) ATP synthase beta chain
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00190  Oxidative phosphorylation
pdi01100  Metabolic pathways
Module
pdi_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:pdi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BDI_0271
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:pdi00194]
    BDI_0271
Enzymes [BR:pdi01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     BDI_0271
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     BDI_0271
Photosynthesis proteins [BR:pdi00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BDI_0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N AAA_16 NB-ARC ATPase T3SS_ATPase_C NACHT RsgA_GTPase TrwB_AAD_bind ATPase_2 AAA_19
Motif
Other DBs
NCBI-ProteinID: ABR42056
UniProt: A6L8P2
LinkDB All DBs
Position
complement(296711..298228)
Genome map
AA seq 505 aa AA seqDB search
MGEIKGYISQVIGPVVDIHFDYGTEETVTLPRIHDAMEISRPNGKILIVEVQQHIGENTV
RTVAMDTTDGLRRGMEAVSYGMPITMPTGDQVKGRLMNVTGDPIDGMAQLTKDGALPIHR
EPPKFEDLTTTQEVLYTGIKVIDLLEPYAKGGKIGLFGGAGVGKTVLIMELINNIAKKNN
GFSVFAGVGERTREGNDLLREMIQSGVIRYGEEFKKSMEAGNWDLSKIDYDELAKSQATL
VFGQMNEPPGARSSVALSGLTIAESFRDKASEGERKDILFFIDNIFRFTQAGSEVSALLG
RMPSAVGYQPTLATEMGAMQERITSTKKGSITSVQAVYVPADDLTDPAPATTFTHLDATT
VLSRKITELGIYPAVDPLESTSRILDPLIVGKEHYDTAQRVKQILQRNKELQDIISILGM
EELSDEDRLTVNRARRVQRFLSQPFSVAEQFTGVPGVMVSIEDTIRGFKMIMDGETDDIP
EQAFLNVGTIEDVLEKAKQLKEQAN
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaataaaaggctatatctcacaggttatcggcccggtagtggatatccacttt
gattatgggacagaagaaacagtaaccctcccccgtatccacgacgccatggagatttcc
cgcccaaacggaaagatcttgatcgtcgaagttcagcaacacatcggggaaaacaccgtc
cgtaccgtagcgatggatacgaccgacggattgagacgaggcatggaggccgtgtcatac
ggaatgcccatcaccatgccgaccggcgaccaagtcaaaggacgtttaatgaatgtcacc
ggcgaccctatcgatggcatggcccagcttactaaagacggggctcttcccatccatcgt
gagcctcctaaattcgaggatctgacaacgacccaagaggtcttgtacacgggtattaaa
gtaatcgatttattggaaccttacgccaaaggaggcaagatcggacttttcggaggagcc
ggagtcggcaaaacggtattgatcatggaattgatcaacaacatcgcaaagaaaaacaac
ggattctccgtcttcgccggtgtgggtgaacgtacacgtgaaggaaatgacctattgcgt
gaaatgatccaatccggtgtcatccgatacggcgaggagtttaagaagagtatggaggca
ggcaactgggacttgtcgaagatcgattacgatgaattggctaagtcgcaggctaccttg
gtattcgggcagatgaacgaaccgccgggcgcccgctcgtccgtggccttatccggtttg
acgatcgccgaatccttccgtgacaaagcctctgagggagaaagaaaagatatattattc
ttcatcgataatatcttccgtttcacccaagccggttccgaggtttccgccttgctgggg
cgtatgccttccgccgtaggttaccaaccgacattggccacggaaatgggagctatgcaa
gagcgtatcacttcaaccaagaagggctccatcacctccgtacaggcggtgtatgttcct
gccgatgacttgacagacccagctccggcgactacctttacgcacttggacgcaacaacc
gtcctcagccgcaagatcacggaactcggtatctatccggccgtagacccgctggaatcc
acctcccgcatccttgatccgctgatcgtaggcaaggagcattacgacacagcgcaacgg
gtaaaacaaatcctgcaacggaacaaggaacttcaagatatcatatccatcctcggtatg
gaagaactttccgacgaggacaggctaacggtcaaccgggcccgccgtgtacaacgtttt
ctgtcccagcccttctccgtggcagaacaattcactggcgtacccggtgtcatggtctct
atagaggatacgatccggggattcaagatgatcatggacggggaaacggatgacataccc
gaacaggcattcttaaacgtaggaaccatcgaggatgtcttggagaaggccaagcagctg
aaagaacaagcaaattaa

DBGET integrated database retrieval system