KEGG   Parabacteroides distasonis: BDI_1817Help
Entry
BDI_1817          CDS       T00549                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00564  Glycerophospholipid metabolism
pdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BDI_1817
Enzymes [BR:pdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BDI_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like Pyr_redox_2 GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ABR43556
UniProt: A6LCZ2
LinkDB All DBs
Position
complement(2166101..2167666)
Genome map
AA seq 521 aa AA seqDB search
MDRSKMISQLEDPSEVFDFLVIGGGATGIGIALDASTRGYRVALFEQSDFTKGTSSRSTK
LVHGGVRYLAQGDVSLVLEALRERGLLRQNAPHLVKDQTFLIPCYRWWEGPFYTIGLILY
DVMAGKLGLGRSVCIGPKRALRTIPMLRPKGMTAGVLYHDGQFDDSRLAINMVRSSIDAG
ACILNYAKVIGLLKDGDRKVSGVTVRDEETGTVYQVRSRCVINASGVFADEILQMDEPGK
RPTVRPSQGVHLVLDSSFLQSDCAIMIPKTSDGRVLFAVPWHDKVVVGTTDTLMESPEKE
PVALEKEIQFILDTAANYLTRPPKRSDVLSVFAGLRPLAAPRSEGKKTKEISRSHKLIRE
KSGLITIIGGKWTTYRKMAQDTLDLAIRYMHIPTKDCITERYQIHGSRKNPDFSDPLYVY
GTDADEIRNLVASSPAMAEKLHPDYAYTVGEVTWLVRNEMPRTLEDVLARRLRILFLDAR
AAMAMAPKVAGILATEWGKDETWTSAQVKAFNEVASNYILN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtagtaaaatgatttctcagttggaagacccgtctgaagtctttgattttctt
gtgatcggaggaggagctaccggcataggtatcgctctggatgcttcgacaagaggatat
agagtcgccttattcgaacaatcggactttacgaaaggaacttccagccgtagcacgaag
ttggtccatggcggtgtccgttatttggcgcaaggagatgtctccttggttctggaagct
ttgcgcgaacgaggcctgctacgccagaacgctccccatttggtaaaagatcaaaccttc
ttaatcccttgttatcgttggtgggaaggcccgttttatacgataggcctgatcctgtat
gatgtgatggccggaaaattaggtctgggacgttcggtttgtatcggtccgaaacgggcg
ctccgtaccattccgatgcttcgtccgaaagggatgaccgccggggtgctttatcacgac
ggccagttcgatgattcccgccttgcgattaatatggtccgcagctctatcgacgctggc
gcttgtatcttgaactacgcgaaagtcatagggcttctgaaggatggcgaccgcaaagta
tccggcgttacggttcgagatgaggagaccggtacggtttatcaagtaagatcccgttgc
gtgatcaacgctagcggtgtcttcgccgatgagatcttgcaaatggacgagccgggcaaa
cgcccgaccgttcgccccagccaaggagtccatttggtattggattcctctttcttgcaa
agtgattgcgccattatgattcctaagacatcggatggacgtgtgttgttcgccgtacct
tggcatgataaagtcgtggtagggacaacggataccttgatggaatcgccggaaaaggag
ccggtagccttagagaaagaaatccaatttatactcgatacggccgctaattatttgacc
cggccacccaagcgaagcgatgtcttatccgtgtttgcggggcttcgtccgctcgccgct
ccccgtagcgaaggtaaaaagacaaaagagatatcacgtagccataaattgatccgggag
aaatccggcttgatcaccattatcggaggcaaatggacaacctaccggaaaatggcccaa
gataccctagacctagcgatacgttacatgcatattcctacaaaagattgtattaccgag
cgttaccaaatccatggtagccggaagaatccggatttctccgatcctttatacgtatat
ggtacggatgccgacgaaatccgtaacttagtggcctcttcccccgctatggcggagaag
ttgcatccggactatgcctatacggtaggagaggtaacttggctggtccgtaatgagatg
cctcgtactttggaggatgtattggcccgccgtttgcgtatcttattcttagacgcacgg
gcggcgatggcgatggctcctaaagtagcggggattctggctacggaatggggaaaggac
gagacttggacctctgctcaggtaaaggcgtttaatgaggttgcctcgaattatatactg
aattga

DBGET integrated database retrieval system