KEGG   Parabacteroides distasonis: BDI_3397Help
Entry
BDI_3397          CDS       T00549                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pdi  Parabacteroides distasonis
Brite
KEGG Orthology (KO) [BR:pdi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BDI_3397
Enzymes [BR:pdi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BDI_3397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like FAD_binding_2 GIDA DAO Thioredoxin_3 FAD_oxidored NAD_binding_7 Thi4 AlaDh_PNT_C NAD_binding_8 FAD_binding_3 Lycopene_cycl Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ABR45099
UniProt: A6LHD5
LinkDB All DBs
Position
4130608..4132161
Genome map
AA seq 517 aa AA seqDB search
MLESTLKEQLKGIFAGLNANYTFDISISPAHESRQELLDLLGDVASCSDKISMRVSDGDG
LEFILLKDGAKTGIKFRGVPNGHEFTSLLLAILNSDGKGKNFPDESICNRVKALNGPIHL
TTYVSLTCTNCPDVVQALNAMTTLNPQIHHEMVDGAINQAEVDALKIQGVPSVFADGKLI
HVGRGEFGELLSKLEAQYGINESLTEKTVKRYDVVVVGGGPAGASSAIYSARKGLSVAVV
AERIGGQVKETVGIENLISVPETTGTQLADNLRLHMRQYPIDLLEHRRIEKVTIEGNEKV
LSTAGGEIFKAPAVIIATGASWRKLNVPGEAEYIGRGVAFCPHCDGPFYKGKHVAVVGGG
NSGIEAAIDLAGICSKVTVLEFMDELKADQVLQEKAKSLPNVEIFVSSQTTEVVGNGDKV
TGIRTKDRKTGEERVIHLDGIFVQIGLAANSGVFKEIVETNRPGEIVIDAHCRTNVPGIY
AAGDVSTVPFKQIIISMGEGAKAALSAFEDRVRGVLD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaatcaacattaaaagaacaattaaaaggtatattcgcagggttaaatgcgaat
tatacctttgatatatcgatctctcctgcgcatgaaagtagacaagagttgttggattta
ttaggtgatgttgcctcttgttcggataaaatatctatgcgagtatctgatggggatgga
ttggaattcattttattaaaggatggagcgaaaacggggattaagtttcgtggagtacct
aatggacacgagtttacttccttgctgttggcgatcttgaattcagatgggaaaggcaag
aattttccggacgagagcatttgtaatcgtgttaaagccttgaatggcccgatacatctg
acgacctatgtctctttgacttgtacgaattgcccggatgtggtacaggcattaaacgct
atgacgactttaaatcctcagatccatcatgagatggtagatggggctatcaatcaggcg
gaagttgatgccttgaagatacaaggcgtcccctctgtctttgcggatggaaaactgatc
catgtaggacgtggggaattcggtgaattgttatcgaagctggaagctcagtatggaatc
aatgagagcctgacagagaagacggtaaaacgatatgacgtggttgtggtcggtggaggg
ccggctggtgcttcttccgctatttattccgcacgaaaggggctgagtgtcgctgtcgtg
gcggagcgtatcggcgggcaggtgaaggagacggtaggaattgagaatctgatttcagtt
ccggagacaacaggtacccagttggctgacaatctgcgcttgcatatgcggcaatatccg
attgacctgctggagcatcgtcgtatagagaaggtaacgatagaaggaaacgagaaggtt
ttgtctacggctggaggtgagatattcaaggctccggcggttattatcgctacgggcgct
agctggcgtaaattgaatgtaccgggtgaggcagagtatatagggcgtggagtggctttt
tgtcctcattgcgacggtccgttttataagggaaaacatgtcgccgtggttggcggtgga
aattccggtatcgaggcggctattgatttggcggggatctgttcgaaagtaaccgttttg
gagtttatggatgagttaaaagcggatcaagtcttgcaagagaaagcgaagagtttgccg
aatgtcgagatctttgttagttcacaaacaaccgaggtggttggaaatggcgacaaggta
accggtatccgtacaaaggatcgtaagacaggggaagagcgtgttattcatttagacggt
atttttgttcaaatcggcttagccgctaatagtggtgtctttaaggagattgtcgaaaca
aatcgtcccggtgagatcgtgattgacgcacattgccggacgaatgtcccgggtatttat
gctgcgggcgacgtttccaccgtaccctttaagcaaatcattatttctatgggagaaggc
gccaaagcggccctttcggcctttgaagatcgggtacgtggcgtacttgattga

DBGET integrated database retrieval system