KEGG   Pseudoalteromonas donghaensis: D0907_02045Help
Entry
D0907_02045       CDS       T05890                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
pdj  Pseudoalteromonas donghaensis
Pathway
pdj00290  Valine, leucine and isoleucine biosynthesis
pdj00770  Pantothenate and CoA biosynthesis
pdj01100  Metabolic pathways
pdj01110  Biosynthesis of secondary metabolites
pdj01130  Biosynthesis of antibiotics
pdj01210  2-Oxocarboxylic acid metabolism
pdj01230  Biosynthesis of amino acids
Module
pdj_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
pdj_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:pdj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    D0907_02045
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    D0907_02045
Enzymes [BR:pdj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     D0907_02045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AXV64139
LinkDB All DBs
Position
443273..445129
Genome map
AA seq 618 aa AA seqDB search
MAKLRSATTTEGRKRAGARALWRATGMTDKDFGKPIIAVVNSYTQFVPGHVHLNQLSELM
AETITEAGGVPKEFNTIAIDDGIAMGHGGMLYSLPSRDLIADSVEYMVNAHCADAMICIS
NCDKITPGMMLAALRLNIPVIFVSGGPMEAGKTRLADIDIKLDLVDAMVKGADSSVSDED
SDKVERSACPTCGSCSGMFTANSMNCLLEAIGLALPGNGTTLATHKDRKQLYVEAGARIV
DLCREYYQKDNADVLPRAIANRTAFMNAMVVDIAMGGSSNTVLHLLAAAQEAGVDFDMSH
IDELSRKTPFLCKVAPATSKYHIEDVHRAGGMMAIIRELGKAGLVDLSVDHVAGMTMAEL
VEKWNATDPNNAVAQKFYKAGPAGIRTTKAMSQECRWPELDNDRENGCIRSVENAFRQDG
GLAVLSGNLALDGCIVKSAGVVEEMLHFEGPAVVYESQDDSVEGILNGEVKAGDVVVIRY
EGPKGGPGMQEMLYPTSYLKSVGLGEKCALITDGRFSGGTSGLSIGHVSPEAASGGAIAY
VENGDKIIIDIATREITLALSDEELEARKQKQLARGKEAFKPRDRERYVSSALKAYALLA
TSADKGAVRDLAKLEELS
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattacgaagtgcaacaacaacagaaggtcgtaaacgcgcaggcgcacgtgca
ttgtggcgtgcaacaggaatgacagataaggacttcggtaagccaattatcgctgttgtg
aattcatacacgcagtttgttccagggcatgttcatttaaatcaactcagtgagttaatg
gccgaaacgattactgaagcgggtggtgtaccaaaagaatttaataccattgcgattgat
gatgggattgcgatgggccacggcggtatgctgtattcgctaccttctcgcgatctgatt
gctgactcagtagagtacatggttaacgcgcattgtgccgatgcgatgatctgtatttct
aactgcgacaaaatcaccccaggtatgatgctggctgcattacgcttaaatattccggtt
atctttgtgtcaggtggaccgatggaagcaggtaaaacccgccttgctgatatcgacatt
aaactcgacttagttgatgccatggtgaaaggtgccgatagctcagtcagcgacgaagac
tcagacaaagtagagcgctcagcgtgcccaacgtgtggttcatgttcggggatgtttacg
gctaactcaatgaactgcttattagaagcaattggtttggcattgcctggtaacggcaca
acacttgccactcataaagaccgtaaacagttatatgttgaagcaggcgcacgcatcgtt
gatttatgccgtgagtattatcaaaaagataatgccgacgtattaccacgtgccatcgcc
aatcgcaccgcttttatgaatgcaatggtggtggatattgcaatgggtggctcatcaaac
acggtgttacatttattagccgcagcccaagaagcgggtgtcgattttgatatgtcacat
attgatgagctttcacgcaaaacgccttttttatgtaaagttgcacctgccacaagcaaa
tatcatattgaagacgtgcaccgcgctggtggcatgatggcaattatccgtgagctaggt
aaagcgggtttagttgatttgtctgtggatcacgttgcagggatgacgatggcggagtta
gttgagaagtggaatgccacagatccaaacaatgccgttgcacaaaaattctataaagca
ggcccagcgggtatccgcaccacgaaggcgatgagccaagaatgtcgttggcctgaactg
gataacgatcgtgaaaatggctgtattcgcagtgttgaaaatgcgtttcgtcaagatggt
ggcttagcggtgctgtcgggaaatttagcgctggatggttgtattgttaaaagtgccggt
gttgttgaagaaatgctgcattttgaaggcccagcagtggtttacgaatcacaggatgat
tcagttgaaggtatattaaatggtgaagtaaaagcgggtgatgttgtggtgatccgctat
gaaggtccaaaagggggcccaggtatgcaagagatgttgtacccgaccagctacttaaaa
tcggtaggtttaggtgaaaaatgtgcattgatcactgatggccgtttttcgggtggtacc
tctggtttgtcgattggtcatgtctcgcctgaggctgccagcgggggagcaattgcgtat
gtagagaacggcgataaaattattattgatatcgccacccgcgaaatcaccttagccctg
agcgatgaagagcttgaagcacgtaagcaaaagcaattagcacgtggtaaagaggccttt
aaaccacgcgatcgtgagcgttatgtatcatcggcactaaaagcgtatgcattattggca
accagtgcagacaaaggggcggtccgtgatttagctaagcttgaggagttaagttaa

DBGET integrated database retrieval system