KEGG   Pseudoalteromonas donghaensis: D0907_02700Help
Entry
D0907_02700       CDS       T05890                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pdj  Pseudoalteromonas donghaensis
Pathway
pdj00473  D-Alanine metabolism
pdj00550  Peptidoglycan biosynthesis
pdj01100  Metabolic pathways
pdj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pdj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D0907_02700
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D0907_02700
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    D0907_02700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pdj01011]
    D0907_02700
Enzymes [BR:pdj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     D0907_02700
Peptidoglycan biosynthesis and degradation proteins [BR:pdj01011]
 Precursor biosynthesis
  Amino acid ligase
   D0907_02700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 RimK ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: AXV64260
LinkDB All DBs
Position
570241..571161
Genome map
AA seq 306 aa AA seqDB search
MSQTSDKFGKVAVLFGGTSAEREVSLKSGQAVLNALQSVGVDAIAFDPKEQPLWQLKERN
IERVFIALHGRGGEDGTIQGALEFMGLPYTGSDVLGSALAMDKVRCKHLFKAMGLSTAPY
TVVDSRHEFDSQAIINEFGKVMVKPSHEGSSIGMAEAHTAEQLDAALNAAFKFDSQVLVE
QWITGREFTVAVLGQDVQPVIEMTTPNGFYDYQAKYQSNTTQYHCPADLSQQETQLLQDM
ALKAFDLVGASGWGRVDAMRDEQGNFYLLEVNTVPGMTEKSLVPMAAKANGASFEQLVVR
ILEQTL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagccagacaagcgacaaatttggcaaagtagcagttctttttggcggtacatcagct
gaacgagaagtctcgcttaaatcgggccaagccgtattgaacgcattgcagagtgttggc
gttgatgccatcgcatttgatcctaaagaacagcctctttggcaattaaaagagcgcaat
attgaacgagtatttatcgcacttcatggccgaggcggtgaagatggtacgattcaaggt
gcgcttgaatttatgggacttccttatactggcagtgatgtattgggctctgcattggct
atggataaagtgcgttgtaagcatttatttaaagcaatgggtttaagcacagcaccttac
accgttgttgatagccgccatgagtttgatagccaagcaatcataaatgaatttggtaag
gtgatggttaagccatcacatgaagggtcaagcattggtatggctgaagcgcatacggct
gagcagttagatgccgctttaaatgcggcctttaaatttgacagccaagtactcgtagag
caatggattacgggtcgtgaatttaccgttgctgttttaggtcaagatgttcagcctgtt
attgaaatgacaacaccgaatggtttttacgactatcaggctaagtatcaatcaaatacc
acgcagtaccattgccctgcagatttatctcagcaagaaacacaattattgcaagatatg
gctcttaaagcctttgatttggttggcgcgagtggctgggggcgtgttgatgcaatgcgt
gatgaacaggggaatttttacttattagaagtgaatacagtcccaggcatgaccgaaaag
tcgttggtgccaatggcggctaaagccaatggtgcaagttttgaacaattagttgttcgc
attctggagcaaacactttaa

DBGET integrated database retrieval system