KEGG   Pseudoalteromonas donghaensis: D0907_07675Help
Entry
D0907_07675       CDS       T05890                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pdj  Pseudoalteromonas donghaensis
Pathway
pdj00020  Citrate cycle (TCA cycle)
pdj00190  Oxidative phosphorylation
pdj00650  Butanoate metabolism
pdj01100  Metabolic pathways
pdj01110  Biosynthesis of secondary metabolites
pdj01120  Microbial metabolism in diverse environments
pdj01130  Biosynthesis of antibiotics
pdj01200  Carbon metabolism
Module
pdj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pdj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pdj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D0907_07675
   00650 Butanoate metabolism
    D0907_07675
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    D0907_07675
Enzymes [BR:pdj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     D0907_07675
    1.3.5.4  fumarate reductase (quinol)
     D0907_07675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_binding_3 Thi4 DAO
Motif
Other DBs
NCBI-ProteinID: AXV65147
LinkDB All DBs
Position
1685752..1687524
Genome map
AA seq 590 aa AA seqDB search
MNYSVREFDAVVIGAGGAGMRAALAITESGKTCALISKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDFIGDQDAIEYMCKTGPEAITELENMGLPFSRFENGRVYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHCLYQQNVKNKTNVFSEWYALDLVKNSDGHVVGC
TAIDIESGEVVYFKSKAVVLATGGAGRIFASTTNAHINTGDGVGMATRAGVAMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLASRDVVARSMMTEIREG
RGCDGPYGPHIKLKLDHLGEETLNLRLPGVCDLAKTFAHVDPAKEPIPVIPTCHYMMGGV
PTNVNGQALQIDANGQEKVVEGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGNFLG
KYLNGVEAGKDASDSDLEASLARFNRWESSKVGQGEDPVQIKKDLQMCMQLNFSVFREGE
AMATGLKELKEIRERLQYARLDDKSTEFNTARIECLELDNLMETAYSTAVAANFRTESRG
AHSRFDYPDRDDENWLCHSIFNPVTDEMSKREVNYAPKLREAFPPKARTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
gtgaattattctgttcgtgaatttgacgctgtagtgattggtgccggtggtgcaggtatg
cgcgcagcacttgcaatcactgagtcaggcaaaacctgtgcacttatctcaaaagttttc
cctacacgttctcacactgtgtctgcacagggtggtattacggtagctctgggtaactca
catgaagataactgggaatggcacatgtacgatacggttaaaggttccgatttcatcggt
gaccaagacgctatcgaatatatgtgtaaaacaggcccagaagctattactgaattagaa
aacatgggcttaccattttctcgttttgaaaatggccgtgtttatcaacgtcctttcggc
ggtcagtcgaaaaactttggtggtgaacaagctgcacgtactgcagccgcagctgaccgt
actggtcacgcattattgcattgtctttaccaacaaaacgttaaaaacaaaacaaatgta
ttctctgagtggtatgcattagaccttgttaaaaacagcgacggtcacgttgttggttgt
acagcaatcgacatcgagtcaggtgaagttgtttatttcaaatctaaagcggttgtttta
gcaacaggtggcgcaggtcgtatctttgcatcaacaactaacgcgcacatcaatacaggt
gacggcgttggtatggcaacacgcgcgggtgttgcaatgcaagatatggaaatgtggcag
ttccacccaaccggtattgctggtgcgggtgtacttgtgacggaaggttgtcgtggtgaa
ggtggttaccttctaaacaaagacggcgaacgtttcatggagcgttatgcacctaatgcg
aaagacttagcatcgcgtgacgttgttgctcgttcaatgatgacagaaattcgtgaaggc
cgtggttgcgatggtccttatggtccacatatcaagcttaagcttgaccacttaggtgaa
gaaactctaaaccttcgtcttccaggtgtttgtgaccttgcgaaaacattcgcacacgtt
gaccctgctaaagagccaattccagttatcccaacatgtcactatatgatgggtggtgta
ccaactaacgtaaatggtcaagcattacaaattgatgcaaatggccaagaaaaagttgtt
gaaggcttattcgctgttggtgaaattgcgtgtgtatctgtacacggcgctaaccgtctt
ggcggtaactcactacttgacttagttgtattcggccgagctgctggtaacttcttaggc
aaatacctaaacggtgttgaagcgggtaaagatgcgtctgattcagaccttgaagcatcg
cttgcacgctttaatcgttgggaaagctctaaagttggccaaggtgaagaccctgttcaa
atcaagaaagacctgcaaatgtgtatgcaacttaacttctcggtattccgtgaaggtgaa
gcaatggcaacaggtcttaaagagcttaaagaaatccgtgaacgtcttcagtatgcgcgt
cttgatgacaaatcaactgaattcaacacagcacgtattgaatgtttagagcttgataac
ttgatggaaacagcttactcaactgcagtagctgcaaacttccgtacagaaagccgtggt
gctcactctcgtttcgactacccagatcgtgatgacgaaaactggctatgtcactcaatt
ttcaatcctgtaacggatgaaatgagcaaacgtgaagtaaactacgcgccgaaactgcgt
gaagctttcccacctaaagcacgtacatactag

DBGET integrated database retrieval system