KEGG   Pseudoalteromonas donghaensis: D0907_07680Help
Entry
D0907_07680       CDS       T05890                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pdj  Pseudoalteromonas donghaensis
Pathway
pdj00020  Citrate cycle (TCA cycle)
pdj00190  Oxidative phosphorylation
pdj00650  Butanoate metabolism
pdj01100  Metabolic pathways
pdj01110  Biosynthesis of secondary metabolites
pdj01120  Microbial metabolism in diverse environments
pdj01130  Biosynthesis of antibiotics
pdj01200  Carbon metabolism
Module
pdj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pdj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pdj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D0907_07680
   00650 Butanoate metabolism
    D0907_07680
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    D0907_07680
Enzymes [BR:pdj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     D0907_07680
    1.3.5.4  fumarate reductase (quinol)
     D0907_07680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AXV65148
LinkDB All DBs
Position
1687535..1688251
Genome map
AA seq 238 aa AA seqDB search
MAQVQFSVYRYNPDIDNAPRMQDFSLETQEGQDMMVLDALMKLKEQDPTLSFRRSCREGV
CGSDGINMNGKNGLACITPLSTLLKGGKGKIVIRPLPGLPVVRDLVIDMSQFYTQYEKVK
PYLINDTPAAGERLQSIEERDKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLHAYR
FLADSRDTATEERLADLDDAFSVFRCHSIMNCVSVCPKGLNPTKAIGQIKSMLLNRSV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagtacaattttccgtttatcgttacaatccagatattgataacgcaccacgt
atgcaagacttctcgctagaaacgcaagaaggtcaagatatgatggtgttggatgcgctt
atgaaattaaaagagcaagatccaacgttatcattccgtcgttcatgccgtgaaggtgtg
tgtggttcagacggtatcaacatgaatggtaaaaatggtttggcatgtatcacgccttta
tcaacgctacttaaaggtggcaaaggtaaaatcgtaattcgtccattacctggtttacct
gtggtacgtgaccttgttattgacatgagtcagttctacactcaatacgaaaaagtaaaa
ccttatcttatcaacgacacgccagcggcgggtgagcgtcttcagtcaatcgaagaacgc
gataagcttgatggtttatatgagtgtattttatgtgcatgttgttcaacatcgtgtcct
tcgttctggtggaatccagacaagttcatcggtccagcaggccttcttcacgcatatcgt
ttcttggctgatagccgcgatacagcgacagaagagcgtcttgctgaccttgacgatgcg
ttcagcgtgttccgttgtcacagtatcatgaactgtgttagcgtgtgtccaaaaggtctt
aatccgaccaaagcaattggacaaatcaagtcaatgcttttaaatcgttcggtttaa

DBGET integrated database retrieval system