KEGG   Pseudoalteromonas donghaensis: D0907_17895Help
Entry
D0907_17895       CDS       T05890                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
Organism
pdj  Pseudoalteromonas donghaensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: AXV67194
LinkDB All DBs
Position
unnamed1:complement(356298..356927)
Genome map
AA seq 209 aa AA seqDB search
MKLYSYFRSSAAYRVRIALNLKNIDHELVTVNLLKSEQQSDAYLAKNPQGLLPALETDHG
VLAQSLAILEWLEETHTEVPLLTGDAWQKAQIRNLCYAVACDIHPIDNLRVLKYLANDLG
VDDEAKNTWYKHWVEVGFDSIEKMLDEGNRFCVGNEPTLADVCLVPQVFNALRFNVDMKK
YPKIAAVYEHCNTLDAFIDAAPQNQPDSI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttatagctattttcgttcatctgcggcgtaccgcgttcgtatcgcccttaat
ttaaaaaacattgatcatgaacttgtaaccgtaaatctattaaaatcggaacagcaaagc
gacgcctatttggcaaaaaacccacaaggccttttgccagcgttagaaaccgatcacggg
gttttagcgcaatcattagctattttagaatggcttgaagaaacccatacagaagtccct
ttactgacgggtgatgcatggcaaaaagcacagatccgtaacctttgttacgccgtagcc
tgtgatattcatccaattgataacttacgcgttttaaaatacttagccaatgatcttggt
gtcgatgatgaggctaagaacacgtggtataagcattgggttgaggtcggattcgacagc
atagaaaaaatgttagatgagggtaatcgtttttgtgtagggaatgagccaaccttagct
gatgtctgtttagtgcctcaagtatttaatgcactgcgttttaacgttgatatgaaaaaa
tatccaaaaatcgccgctgtgtatgaacactgtaatacacttgatgcatttattgatgca
gccccgcagaatcaacccgattcaatataa

DBGET integrated database retrieval system