KEGG   Pseudoalteromonas donghaensis: D0907_19815Help
Entry
D0907_19815       CDS       T05890                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pdj  Pseudoalteromonas donghaensis
Brite
KEGG Orthology (KO) [BR:pdj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D0907_19815
Enzymes [BR:pdj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D0907_19815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 NAD_binding_8 K_oxygenase FAD_binding_3 Glutaredoxin NAD_binding_9 Lycopene_cycl FMO-like
Motif
Other DBs
NCBI-ProteinID: AXV67548
LinkDB All DBs
Position
unnamed1:831650..833230
Genome map
AA seq 526 aa AA seqDB search
MLDTNIKNQLASHFASITSPVELLIALDDSNKSTELKSLATDLASLSDKFSVRDNPDQGV
RRPSMVVSSPVNNTQIIFAGVPMGHEFTSLVLALLHTGGHPSKASDAEIEQIKSLTGPLN
FEVYISLSCQTCPQVVQALNLMAAHNQNITATMIDGALFQDEVNERNILAVPAVYLNGEL
FSQGAVNLTDILNKVDTKAAARQADALNDKALFDVLVVGGGPAGASAAIYSARKGLNTGV
VAERFGGQVADTLAIENFISVKATEGPKLVAQLEEHVKEYGVDVMQNQRAASLTKQDNYQ
ITLENGAVLNAKSVVLATGARWREMNVPGEKEYRGHGVAYCPHCDGPLFKGKAVAVIGGG
NSGIEAAIDLANIVEHVTVLEFADTLRADEVLIRKAKSLSNITIIKNAQTTEVVGDGKRV
TGLSYIDCVTGDEKSLALAGIFVQIGLVPNTEWLKDSDVSLTRFGEIEIDSKGATSLPGV
YAAGDATTTPFKQIIIAMGSGATASLGAFDYLIRHSDETQHTENAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttagatacaaatatcaaaaaccaattagcaagccactttgcttctattaccagccct
gttgagctgcttatcgccttggatgacagcaataaatcaacagaactaaaaagcttagcg
actgatttagcatcgttaagcgacaaattttcggtgcgagacaacccagaccaaggtgta
cgtcgtccttcaatggtggtgtcttcacctgtaaacaatacgcaaatcatttttgccggt
gtgccaatgggccacgaatttactagcttggttcttgcattactgcacacaggtggccac
ccaagcaaagcgtcagacgctgaaattgaacaaattaaatcattaactggcccgcttaat
ttcgaagtatatatttcattaagctgtcagacgtgtccgcaagtagtacaagcacttaac
ttaatggcggcgcacaatcagaacataacagccacaatgattgatggtgctttgttccaa
gatgaagtgaacgagcgcaatattctggcggtaccggctgtttatttaaatggtgaattg
ttcagccaaggtgctgtgaacttaaccgacattttaaataaagtagacaccaaagctgca
gcacgacaggctgatgcgctgaacgacaaagcgttattcgatgtattagttgtagggggc
ggcccagcgggggcttctgcggctatttactcagcgcgtaaaggtttaaacaccggagtg
gtcgcagagcgatttggtggtcaggttgcagacacattagccattgagaactttatctct
gtaaaagcaactgaaggccctaagttagttgcgcaacttgaagagcacgttaaagaatac
ggtgttgatgtgatgcaaaaccaacgtgctgcgtcattaactaaacaggataactatcaa
attaccttagaaaatggtgcggtattaaatgccaaatcggttgtattggcaacgggtgcc
cgctggcgtgaaatgaatgtgccgggcgagaaagagtatcgcggccatggtgttgcatac
tgtccgcattgcgacggcccgttatttaaaggcaaagcagtcgcagtgattggggggggt
aactcaggtattgaagcagctattgaccttgctaacatcgttgagcatgtcaccgtgctt
gaatttgctgacacattacgcgcagatgaggtacttattcgtaaagcgaaaagcttaagt
aacatcacaatcattaaaaacgcgcaaacaaccgaagttgtcggcgatggcaagcgagta
acaggtttaagctacattgattgtgtcactggcgatgaaaagtcgcttgcactggctggc
attttcgttcaaatcggtttagtaccaaacactgagtggttaaaagactcagatgtgtca
ttgactcgctttggtgaaattgaaatcgacagtaaaggggcgacttctttacccggtgtg
tatgctgcgggtgatgccacgacaacaccgtttaaacaaatcattattgccatgggcagt
ggtgcaacggcaagtttaggtgcatttgattatttaatccgccacagtgatgagactcaa
cacactgaaaatgcagcctaa

DBGET integrated database retrieval system