KEGG   Pseudomonas aeruginosa DK2: PADK2_03860Help
Entry
PADK2_03860       CDS       T02161                                 

Definition
(GenBank) hypothetical protein
Organism
pdk  Pseudomonas aeruginosa DK2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_3
Motif
Other DBs
NCBI-ProteinID: AFM63065
LinkDB All DBs
Position
836040..836456
Genome map
AA seq 138 aa AA seqDB search
MTDKKEQIARFIQREFPQTRVVVEAVGERSATVWQAVDASDLRPGGTVSGPTLMAIADVA
LYVAVLGEIGIVPLAVTTSLTINFLRRPAADRRVVAECRLMKVGKTLAMGEVSLFSEGDA
EPVAHVVGTYSIPPAHRR
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacaagaaagagcagatcgcccgtttcatccagcgcgaatttccccagacccgg
gtcgtggtcgaagccgtcggcgagcgtagcgccacggtctggcaggcggtcgacgccagc
gacctgcgccccggcggcacggtctccgggccgaccctgatggccatcgccgatgtcgcg
ctgtacgtggcggtactgggcgagatcggcatcgtcccgctggcggtgaccaccagcctg
accatcaacttcctgcggcgtccggcggcggaccgccgggtggtcgccgagtgccgcctg
atgaaggtcggcaagaccctggcgatgggcgaggtctcgctgttctccgaaggcgacgcg
gaaccggtcgcccatgtggtcggcacctactcgatcccaccggcgcaccgccgctga

DBGET integrated database retrieval system