KEGG   Pseudomonas aeruginosa DK2: PADK2_09275Help
Entry
PADK2_09275       CDS       T02161                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00071  Fatty acid degradation
pdk00280  Valine, leucine and isoleucine degradation
pdk00281  Geraniol degradation
pdk00310  Lysine degradation
pdk00362  Benzoate degradation
pdk00380  Tryptophan metabolism
pdk00410  beta-Alanine metabolism
pdk00640  Propanoate metabolism
pdk00650  Butanoate metabolism
pdk00903  Limonene and pinene degradation
pdk00930  Caprolactam degradation
pdk01100  Metabolic pathways
pdk01110  Biosynthesis of secondary metabolites
pdk01120  Microbial metabolism in diverse environments
pdk01130  Biosynthesis of antibiotics
pdk01200  Carbon metabolism
pdk01212  Fatty acid metabolism
Module
pdk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PADK2_09275 (fadB)
   00650 Butanoate metabolism
    PADK2_09275 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PADK2_09275 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PADK2_09275 (fadB)
   00310 Lysine degradation
    PADK2_09275 (fadB)
   00380 Tryptophan metabolism
    PADK2_09275 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PADK2_09275 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PADK2_09275 (fadB)
   00281 Geraniol degradation
    PADK2_09275 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PADK2_09275 (fadB)
   00930 Caprolactam degradation
    PADK2_09275 (fadB)
Enzymes [BR:pdk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PADK2_09275 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PADK2_09275 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PADK2_09275 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PADK2_09275 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFM64144
LinkDB All DBs
Position
2012634..2014781
Genome map
AA seq 715 aa AA seqDB search
MIYQGKAITVKPLEGGIVELNFDLKGESVNKFNRLTLSELRAAVDAIKADASVKGVIVTS
GKDVFIVGADITEFVDNFQLPDEELMAGNLEANKIFSDFEDLDVPTVAAINGIALGGGLE
MCLAADFRVMSATAKVGLPEVKLGIYPGFGGTVRLPRLIGCDNAVEWIASGKENKAEDAL
KVGAVDAVVAPEQLQAAALDLAKRAVAGELDHKARRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKSIQKAANFGRDKALEVEAAGFVKLAKTSVAQSLIGLFLNDQEL
KKKAKKYDEVAKDVKLAAVLGAGIMGGGIAYQSALKGTPILMKDIREEGIQMGLNEAAKL
LGKRVEKGRLTPAKMAEALNGIRPTMSYGDFGNVDIIVEAVVENPKVKQAVLAEVEGAVK
EDAIIASNTSTISISLLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTGETAIATTVA
YAKKMGKSPIVVNDCPGFLVNRVLFPYFGGFAKLLSFGVDFVRIDKVMEKFGWPMGPAYL
SDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKRGKP
KKVTDPQAYEVLKPIVVEQREVTDEDIVNFMMIPLCLETVRCLEDGIVETAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVALADKYAELGALYHPTAKLREMAKNGQKFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaaggtaaagccatcacggttaagcctcttgagggcggcatcgtcgagttg
aatttcgatctcaagggcgagtccgtcaacaagttcaaccgtctcaccctcagtgagttg
cgtgcggcagtcgatgcgatcaaggccgatgcatcggtcaagggcgtgatcgtgaccagc
ggcaaggacgtgttcatcgttggtgccgacatcaccgagttcgttgacaacttccagctg
cccgacgaggaactgatggcgggcaacctcgaagccaacaagatcttcagcgacttcgaa
gacctggacgtacccaccgttgccgcgatcaacggcatcgccctcggcggcggcctggag
atgtgcctggccgcggacttccgcgtgatgagcgcgaccgccaaggtcggcctgccggaa
gtcaagctgggcatctacccgggcttcggcggcaccgtccgcctgccgcgcctgatcggc
tgcgataacgccgtcgagtggatcgcctcgggcaaggaaaacaaggccgaggacgccctg
aaggtcggcgccgtcgacgccgtggtcgctcccgagcaactgcaggccgctgccctcgac
ctggccaagcgcgccgtcgccggcgagctggaccacaaggcacggcgccagccgaagctg
gaaaagctgaagctgaatgcaatcgagcagatgatggccttcgaaaccgccaagggcttc
gtcgccggccaggccggtccgaactacccggcgccggtggaagccatcaagagcatccag
aaggccgccaacttcggccgcgacaaggcgctggaagtcgaagccgccggcttcgtcaag
ctggccaagacctcggtcgcgcagagtctgatcggcctgttcctgaatgaccaggaactg
aagaagaaagccaagaaatacgacgaagtcgccaaggacgtgaaactggccgccgtgctc
ggcgccggcatcatgggcggcggcatcgcctatcagtcggcgctcaagggcaccccgatc
ctgatgaaggatatccgcgaagagggtatccagatgggcctgaacgaggccgccaagctg
ctcggcaagcgcgtcgagaagggtcgcctgaccccggcgaagatggccgaggcgctcaat
ggcatccgtccgaccatgtcctatggcgacttcggcaacgtcgacatcatcgtcgaagcc
gtcgtcgagaaccccaaggtcaagcaagccgtgctcgccgaagtggaaggcgcggtgaag
gaagacgcgatcatcgcctccaacacctcgaccatctccatcagcctgctggcccaggcg
ctgaagcgtccggaaaacttctgcggcatgcatttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaagaccggtgaaaccgccatcgccaccaccgtcgcc
tacgccaagaagatgggcaagagcccgatcgtggtcaacgattgccccggcttcctggtc
aaccgtgtgctgttcccgtacttcggcggcttcgccaagctgctgagcttcggcgtcgac
ttcgtgcgcatcgacaaggtgatggagaagttcggctggcccatgggcccggcctacctg
tccgacgtggtcggcatcgacaccggccaccatggccgcgacgtcatggccgagggcttc
ccggaccgcatggcggtcgagggcaagaccgccgtcgacgtgatgtacgaggccaaccgc
ctgggccagaagaacggcaagggcttctacgcctacgagaccgacaagcgcggcaagccg
aagaaggtcaccgatccgcaggcctacgaagtgctcaagccgatcgtggtcgagcagcgc
gaagtgaccgacgaggacatcgtcaacttcatgatgatcccgctgtgcctggaaaccgtg
cgttgcctggaagacggcatcgtcgagaccgctgccgaggccgatatgggcctgatctac
ggcatcggcttcccgcccttccgtggtggtgctctgcgctacatcgattcgatcggtgtc
gccgagttcgtggccctggccgacaagtacgccgagctgggcgcgctgtaccacccgacc
gcgaagctgcgtgaaatggccaagaacggtcagaaattcttcggttaa

DBGET integrated database retrieval system