KEGG   Pseudomonas aeruginosa DK2: PADK2_16635Help
Entry
PADK2_16635       CDS       T02161                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00061  Fatty acid biosynthesis
pdk00780  Biotin metabolism
pdk01100  Metabolic pathways
pdk01130  Biosynthesis of antibiotics
pdk01212  Fatty acid metabolism
Module
pdk_M00083  Fatty acid biosynthesis, elongation
pdk_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PADK2_16635
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PADK2_16635
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PADK2_16635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pdk01004]
    PADK2_16635
Enzymes [BR:pdk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PADK2_16635
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PADK2_16635
Lipid biosynthesis proteins [BR:pdk01004]
 Fatty acid synthase
  Component type
   PADK2_16635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AFM65606
LinkDB All DBs
Structure
PDB: 

Position
3608366..3609163
Genome map
AA seq 265 aa AA seqDB search
MGFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPE
LCFPCDVADDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTAVTTREGFRIAHD
ISAYSFIALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSL
GAEGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRNVTIEEVGNAGAFLCSDLA
SGISGEILYVDGGFNTTAMGPLDDD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggatttctcacaggaaaacgcgccctgatcgtcggagtcgccagcaagctctccatc
gcttccggcatcgccgccgccatgcaccgggaaggcgccgaactggccttcacctaccag
aacgacaagctcaggggccgggtggaggagttcgccagtggctggggctcgcggccggag
ctgtgcttcccctgtgacgtggccgacgacagccagatcgaagcggtgttcgccgccctg
ggcaagcactgggacggcctggacatcatcgtccactccgtcggattcgctccaggcgat
cagctcgacggcgacttcaccgcggtgaccacccgcgagggcttccgcatcgcccacgac
atcagcgcctacagcttcatcgccctggccaaggccggacgggaaatgatgaagggccgc
aacggcagcctgctgaccctctcctacctgggcgccgaacggaccatgccgaactacaac
gtaatgggcatggccaaggccagcctggaggccggggtccgctacctggccggcagcctg
ggcgcggaaggcacccgggtcaatgcggtttccgccgggccgatccgaacgctcgccgcc
tccgggatcaagagtttccgcaagatgctggccgccaacgagcggcagacgccgctgcgg
cgcaacgtcaccatcgaggaagtcggcaatgccggcgccttcctctgttcggacctggcc
agcggtatcagtggcgagatcctctacgtcgatggcggcttcaacactaccgccatgggc
ccgctggacgacgactga

DBGET integrated database retrieval system