KEGG   Pseudomonas aeruginosa DK2: PADK2_17265Help
Entry
PADK2_17265       CDS       T02161                                 

Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00270  Cysteine and methionine metabolism
pdk00330  Arginine and proline metabolism
pdk00410  beta-Alanine metabolism
pdk00480  Glutathione metabolism
pdk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PADK2_17265
   00330 Arginine and proline metabolism
    PADK2_17265
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PADK2_17265
   00480 Glutathione metabolism
    PADK2_17265
Enzymes [BR:pdk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     PADK2_17265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_11 MTS Methyltransf_12 Methyltransf_30
Motif
Other DBs
NCBI-ProteinID: AFM65732
LinkDB All DBs
Position
complement(3733255..3734115)
Genome map
AA seq 286 aa AA seqDB search
MSDYQETLYQGYGQRFSIDNMLHEVRTEHQHLVIFENARMGRVMALDGVIQTTEADEFIY
HEMLTHVPILAHGAARRVLIIGGGDGGMLREVAKHKSVERITMVEIDGTVVDMCKEFLPN
HSQGAFDDPRLNLVIDDGMRFVATTEERFDVIISDSTDPIGPGEVLFSENFYQACRRCLN
EGGILVTQNGTPFMQLEEVRTTAARTDGLFADWHFYQAAVPTYIGGAMTFAWGSTREGLR
RLPLETLRQRFRDSGIATRYYNADIHLGAFALPQYVLQAIGKQDND
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattatcaggaaactctgtaccagggctacggccagcgcttcagcatcgacaac
atgctgcatgaggtgcgcaccgagcaccagcacctggtgattttcgaaaacgcccggatg
ggccgggtgatggcgctcgacggagtgatccagaccaccgaggccgacgagttcatctac
cacgagatgctcacccacgtgccgatcctcgcccacggcgcggcccggcgcgtgctgatc
atcggcggcggcgacggcggtatgctgcgcgaggtggccaagcacaagagcgtcgagcgg
atcaccatggtcgagatcgacggcaccgtggtcgacatgtgcaaggagttcctgcccaac
cactcccagggcgccttcgacgacccgcggctgaacctggtgatcgacgacggcatgcgc
ttcgtggctaccacggaagaacgcttcgacgtgatcatctccgactccaccgacccgatc
ggccctggcgaggtgctgttctccgagaacttctaccaggcctgccggcgctgcctgaac
gagggtggcatcctggtcacccagaacggcacgccgttcatgcaactggaggaagtgcgc
accaccgccgcacgtaccgacgggctgttcgccgattggcatttctaccaggcggcggtg
ccgacctatatcggcggcgccatgaccttcgcctggggctcgacccgcgaaggcctgcgt
cgccttccgctggaaacgctgcgccagcgcttccgcgacagcggcatcgccacccgctac
tacaacgccgatatccacctgggcgcgtttgctctgccgcagtatgtgctgcaggccatc
ggcaagcaggacaacgactga

DBGET integrated database retrieval system