KEGG   Pseudomonas aeruginosa DK2: PADK2_18080
Entry
PADK2_18080       CDS       T02161                                 

Gene name
ligA
Definition
(GenBank) NAD-dependent DNA ligase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk03030  DNA replication
pdk03410  Base excision repair
pdk03420  Nucleotide excision repair
pdk03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pdk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PADK2_18080 (ligA)
   03410 Base excision repair
    PADK2_18080 (ligA)
   03420 Nucleotide excision repair
    PADK2_18080 (ligA)
   03430 Mismatch repair
    PADK2_18080 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pdk03032]
    PADK2_18080 (ligA)
   03400 DNA repair and recombination proteins [BR:pdk03400]
    PADK2_18080 (ligA)
Enzymes [BR:pdk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     PADK2_18080 (ligA)
DNA replication proteins [BR:pdk03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     PADK2_18080 (ligA)
DNA repair and recombination proteins [BR:pdk03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     PADK2_18080 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     PADK2_18080 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     PADK2_18080 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PADK2_18080 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 DNA_ligase_ZBD BRCT HHH_5 PTCB-BRCT
Other DBs
NCBI-ProteinID: AFM65891
LinkDB
Position
complement(3902131..3904515)
AA seq 794 aa
MTDTQAAAERIAQLRTELDTHNYRYYVLDEPSIPDAEYDRLFRELQALEAEYPQLLTPDS
PTQRVSGTPASAFGEVRHEIPMLSLGNAFEEQDLLDFDRRVREGLADLLPGGDLLGGGAE
VEYSCEPKLDGLAVSLLYERGQLVRGATRGDGSTGEDITSNVRTIRNVPLKLHGEGWPEI
LEVRGEVFMSKAGFEALNAKAVETGGKTFANPRNAAAGSLRQLDSKITASRPLEFCAYGF
GQVSGTLPDTQVGILEAFRGWGIPISRELRLVKGAQACRDYYDDIGRRRDALAYEIDGVV
FKVNRIAFQRELGFRAREPRWAIAHKFPAREELTELLGVEFQVGRTGAVTPVARLKPVQV
AGVTVSNATLHNMDEVARLGLRIGDTVVIRRAGDVIPQVMQVVLERRPADAQAIEVPEHC
PVCGSAVERTQLVKRSKGKESISEGAIYRCVGRLSCQAQLKQAIIHFVSRRAMDIDGLGD
KIVEQLVDRGLVASPADLYTLTYEQVFELEGFAELSTNNLLAAIADSRKPSLARFIFALG
IPDVGEETAKLLARSLGSLERIGKALPEVLTYLPDVGAEVAYEIHNFFADEHNRQVIAQL
RDAEHGVQLQEEGEVAAEFAACASLAGFIDKLNIPFIAATGAEKLASRFGSLDGIIRADW
LDLRQVERLPERAAKSLRDFFDEPANVQRALAIEAQLREFGMHWQSERKAVEGLPLAGQT
WVLTGTLEAMSRDVAKDKLEGLGAKVAGSVSAKTHCVVAGPGAGSKLAKANELGVKVLDE
DGLLKLFDEHGVAR
NT seq 2385 nt   +upstreamnt  +downstreamnt
atgaccgacacccaggctgccgccgaacgcatcgcgcaactgcgaaccgaactggacacc
cacaattaccgttactacgtgctcgacgaaccgagcattcccgacgccgaatacgatcgc
ctgttccgcgagttgcaggcgctggaggccgagtacccgcaactgctgacgcccgactcg
ccgacccagcgggtcagcggcacgccggcctcggcgttcggcgaagtgcgccatgagatc
cccatgctcagcctcggcaacgccttcgaggagcaggacctgctggacttcgaccgccgc
gtacgcgaaggactggccgacctgttgcctggcggcgacctgctcggcggtggcgcggag
gtcgagtacagttgcgagccgaagctggacggcctggccgtcagcctgctctacgagcgc
ggccaactggtgcgcggcgccacccgcggcgatggcagcaccggcgaggacatcaccagc
aacgtacgcaccattcgcaacgtacctctgaagctgcatggcgaaggctggccggagatc
ctcgaagtgcgcggcgaggtgttcatgtccaaggccggtttcgaggcgctcaacgccaag
gccgtggaaaccggcggcaagaccttcgccaacccgcgcaacgcggcggccggcagcctg
cgccagctggattcgaagatcaccgccagtcgcccgctggagttctgtgcctacggcttc
ggccaagtcagcgggacgctgccggacacccaggtgggcatcctcgaggcgttccgcggc
tggggtatccccatcagtcgcgagctgcgcctggtcaagggcgcccaggcctgccgcgac
tactacgacgacatcggtcgccgacgcgatgcgctggcctacgagatcgacggcgtggtg
ttcaaggtcaaccgcatcgccttccagcgcgaactgggcttccgcgcgcgcgagccgcgt
tgggcgatcgcccacaagttccccgcgcgcgaggagctgaccgagctgctgggtgtcgag
ttccaggtcggccgcaccggcgccgtgaccccggtggcacgcctcaagccggtgcaggtg
gccggcgtcacggtgtccaatgcgaccctgcacaacatggatgaagtcgcccgcctgggc
ctgcgcatcggcgatacggtggtgatccgccgtgctggcgatgtgattccgcaggtcatg
caggtggtgctcgagcgccgcccggcggatgcgcaggctatcgaggtgcccgagcattgc
ccggtctgcggctcggccgtggagcggacccagttggtcaagcgcagcaagggcaaggag
tcgatcagcgagggcgccatctatcgctgcgtcggccgcctctcctgtcaggcgcagttg
aagcaggcgatcatccatttcgtatcgcgccgggcaatggacatcgacggtcttggcgac
aagatcgtcgagcaactggtggatcgcgggctggtcgcctcgccggcggatctctatacc
ctgacctatgaacaggtgttcgagctggaagggttcgccgagctgtccaccaacaacctg
ctggcggccatcgccgacagccgcaagccttcgctggcgcgcttcatcttcgccctgggg
attcccgacgtcggcgaggaaaccgccaagctgctggcgcgttcgctgggttcgctcgag
cggatcggcaaggcgctgccggaagtgttgacctacctgccggacgtcggcgccgaggtg
gcctacgagatccacaacttcttcgccgacgagcacaaccgccaggtgatcgcccagttg
cgcgatgccgaacatggcgtgcagttgcaggaagagggcgaggtcgccgcggagttcgcc
gcttgtgcctcgctggccggtttcatcgacaagctgaacattcccttcatcgccgccacc
ggcgcggaaaagctggccagccgcttcggttcgctcgacggcatcatccgcgccgactgg
ctcgatctacgccaggtggagcgtctgcccgagcgagcggcgaaaagcctgcgcgatttc
ttcgacgagccggccaacgtgcagcgtgccctggccatcgaggcgcagttgcgtgagttc
ggcatgcattggcagagcgagcgcaaggcggtcgaaggcctgcctctggccgggcagacc
tgggtgctgaccggcaccttggaggcgatgagccgggacgtggccaaggacaagctggaa
gggctcggcgccaaggtggccggctcggtgtcggccaagacccactgcgtggtcgccggg
cccggcgccggctcgaagctggccaaggccaacgagctgggcgtgaaggtgctcgacgaa
gacggcctgctgaaactgttcgacgagcacggcgtcgcccgctga

DBGET integrated database retrieval system