KEGG   Pyrodictium delaneyi: Pyrde_0136Help
Entry
Pyrde_0136        CDS       T04114                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pdl  Pyrodictium delaneyi
Pathway
pdl03030  DNA replication
pdl03410  Base excision repair
pdl03420  Nucleotide excision repair
pdl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pdl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pyrde_0136
   03410 Base excision repair
    Pyrde_0136
   03420 Nucleotide excision repair
    Pyrde_0136
   03430 Mismatch repair
    Pyrde_0136
Enzymes [BR:pdl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Pyrde_0136
    6.5.1.6  DNA ligase (ATP or NAD+)
     Pyrde_0136
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Pyrde_0136
DNA replication proteins [BR:pdl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Pyrde_0136
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Pyrde_0136
DNA repair and recombination proteins [BR:pdl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Pyrde_0136
   NER (nucleotide excision repair)
    Other NER factors
     Pyrde_0136
   MMR (mismatch excision repair)
    Other MMR factors
     Pyrde_0136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ALL00186
UniProt: A0A0P0N1P3
LinkDB All DBs
Position
110650..112455
Genome map
AA seq 601 aa AA seqDB search
MPFSTLAETFEKLERVTSRTQMLLYLVELFKKTPPDVIDKVVYFLQGKLWPDWKGLPELG
VGEKLLIKAAAIALHVSEHQLEQMAKRLGDIGRTIEIIKTEKEKKASAPGLLAFMKKPST
STTGLTVEKVYDTLAKIALAQGEGSRDIKLKLLAGLLAEASPKEAKYIARFVEGRLRLGV
GDATIMEALAVVYAGSAAMRSIVERAYNLRADLGMIAKILATEGVDTLKNIKPEVGIPIR
PMLAERLNDPVEILKKLGGRALVEYKYDGERAQIHKKGDKIWIFSRRLENITHMYPDVVE
MARKGIKVEEAIVEGEIVAIDPDTGELRPFQVLMHRRRKHDIHIVLSEIPVAVYLFDTVY
VDGNDLTVKPLPKRHEMLEKIIEPSDRWQIAKGIVTDSPEELETFFLKAIEDGAEGVMAK
AMHDRSIYQAGSRGWLWIKYKRDYKSEMNDTVDLVVIGAFYGKGRRGGKFGALLMAAYDP
DTDTFKSVCKVGSGFTDEDLERLDDMLKPYIRDHKPARVDSQMKPDVWVEPALVAEIIGA
ELTLSPIHTCCYGWAKKGAGISIRFPRFIRWRPDKGPEDATTTKELYEMYQRQLRKVKEQ
T
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgccattctccacactggctgaaaccttcgagaagctggagcgggtcacatcgcgtaca
cagatgctcttgtacctggtagaactcttcaagaagacaccaccggatgtgatagacaag
gttgtctacttcctacagggtaagctctggcccgactggaaaggcctgccagagcttggt
gttggcgaaaagcttctcataaaagcagctgctatagcactccatgtctctgaacatcag
ttagaacagatggctaaaagactaggtgacataggtcgtactatagagataattaagact
gagaaagagaagaaagcttcagccccaggactactagcattcatgaagaagccgagtaca
agtacaacagggcttaccgttgagaaagtctacgatacattggcaaagatagcactggcg
caaggagagggaagccgagacataaagctaaagttgctcgcggggctgctagctgaggct
tctcccaaagaggccaaatatattgcacgtttcgttgaaggacgtctaaggttaggagta
ggagatgcaacaatcatggaggctcttgcagtagtatacgctggcagtgcggctatgaga
agtattgtagagagagcttacaacttgcgcgcagacttgggtatgatagctaagatactg
gctacagagggcgtggatactctgaaaaacattaagcctgaagtgggtataccaattagg
cctatgttggctgaaagactcaatgatccagtagagatattgaaaaaacttggtggtagg
gcacttgtagaatacaagtatgacggtgaacgggctcaaatacataaaaaaggagataag
atatggatattctctcgccgtctagagaacataacacatatgtacccggatgtagtagaa
atggcccgcaaaggcataaaagtcgaggaagccatagtagagggtgaaatagtagccata
gatccagatacgggtgagctacggcccttccaggttctaatgcatcggcgtcgcaaacat
gatatccacatagtcctatctgagatcccagtcgcggtatacctctttgatacagtctac
gtagatggcaacgacttgacagtgaaaccactgcccaagagacatgaaatgctcgaaaaa
atcatagaaccgagcgaccggtggcaaatagcaaaaggtatagtgacagatagccccgaa
gagttagaaacattcttcctcaaagctatagaggacggagcagaaggtgtgatggcaaag
gctatgcatgaccgtagcatataccaagcaggctcccgcgggtggctatggataaagtat
aagcgtgactacaagtccgaaatgaatgatactgtggacctcgtagtaataggagcattt
tatggtaagggtcggcgcggtggcaagtttggagcattgctcatggcagcctatgaccct
gacactgatacattcaagagtgtatgtaaggttggcagtggcttcactgacgaagatcta
gaacgcttagacgatatgttaaaaccatatatacgtgaccataaaccggctcgtgttgat
agccagatgaagccagatgtatgggttgagccggcattagtagccgagattataggtgca
gagttaacactaagtccaatacatacatgttgttatggctgggcaaagaagggagcaggt
atctcaataagattcccgcgattcataaggtggcgtccagacaagggtcctgaggatgca
acaaccacaaaggagctatatgagatgtaccagcgacaactaagaaaggtaaaagagcag
acctag

DBGET integrated database retrieval system