KEGG   Pyrodictium delaneyi: Pyrde_1506Help
Entry
Pyrde_1506        CDS       T04114                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pdl  Pyrodictium delaneyi
Pathway
pdl00630  Glyoxylate and dicarboxylate metabolism
pdl01100  Metabolic pathways
pdl01120  Microbial metabolism in diverse environments
pdl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pyrde_1506
Enzymes [BR:pdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Pyrde_1506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N LigA
Motif
Other DBs
NCBI-ProteinID: ALL01549
UniProt: A0A0P0N571
LinkDB All DBs
Position
1500010..1501347
Genome map
AA seq 445 aa AA seqDB search
MVPRLPEKFDIIYHEFVDENYKPSGTDLIVVFRVTPAKGISIYDAAGRVAAESSVGTWTT
LSVKPSLFEKLKAKAYRLHDLGDGSWLVWVAYPLELFEEGSIPNLASSVLGNIFGMKAIE
GLRVEDIVFPREYIEWFPGPQHGVTGVREILKIRDRPILATVPKPKLGYTPEEYGKIAYE
ILVGGVDLVKDDENFAGQKFCRFEARLREVMKAIDKAEKETGERKGYLANVTANIKEMEK
RIKLVADYGNQFIMIDFLTVGWAALHHARELAEEYKLAIHGHRAFHAAFTRNPRHGVSMF
VIAKLGRLAGLDHLHIGTPSVGKMDAKTMEVIDYARLLREPVFKPREDDIIHMEQDWAGL
KPVLPVSSGGLHPGNLQPVIEKLGADVLLQVGGGVIGHPDGPRAGAAAVRQAIDAILRGI
PLDEYAKEHRELARALEKWGHVRPV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctagattgcctgaaaagttcgacatcatataccacgaattcgtagacgaaaac
tacaagccgagtggaactgacctaatcgtcgtctttcgcgtcacgccagccaagggcatc
tctatatatgatgctgctggccgcgtcgcagccgagagcagtgtaggtacgtggaccaca
ctgagcgtaaagcccagcttatttgaaaaactgaaggcaaaggcttatcgactccacgat
ctaggcgatggtagctggcttgtatgggtagcctatcccttggagctgttcgaagaggga
agtatccccaatctagccagcagtgtgctcggcaacatatttggcatgaaagcaattgaa
gggctccgtgtagaagacatagtgtttccacgggagtatatcgagtggttccccggacca
cagcacggtgttactggtgtaagagagatactcaagatacgcgatcgccccatcctggct
actgtacctaagcccaagctaggctatacgccagaagagtatggtaaaattgcctacgag
atactagtaggcggcgtcgacctagtaaaggatgacgagaatttcgcgggacagaagttc
tgtaggttcgaagctaggctccgcgaggtaatgaaggccatcgataaagcggagaaggag
acaggggagaggaaaggttacctcgcaaacgtgacagctaacataaaggagatggaaaag
aggatcaagcttgtcgcggactatggtaaccagttcataatgatagacttccttaccgtt
ggctgggctgccctacatcatgcccgagaactagctgaggagtacaagctcgccatccat
ggccatcgggcgttccacgccgccttcacccgtaacccccgccacggtgtctcaatgttc
gtcatcgctaagctcggccgcctagctggactagatcacctccatatagggacacccagc
gtaggaaagatggatgcaaaaactatggaggtcatcgattacgcccggctgcttcgggag
ccggtattcaaaccacgagaggacgacataatccacatggagcaggactgggctgggctc
aagccagtacttcctgtctccagcggaggactacaccccggcaacttgcagcccgtaata
gagaagctcggtgcagatgttctacttcaagtcggcggtggcgtaataggccatcctgac
ggccctagggcaggcgcggcagctgtaagacaagcgatagacgctatattgaggggaatc
ccgctagacgagtacgcaaaggagcaccgggagctggcccgggcgcttgaaaagtggggc
cacgttagaccggtctag

DBGET integrated database retrieval system