KEGG   Pediococcus damnosus: ADU72_1294Help
Entry
ADU72_1294        CDS       T04321                                 

Definition
(GenBank) transport protein
Organism
pdm  Pediococcus damnosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: AMV67227
UniProt: A0A143AK66
LinkDB All DBs
Position
complement(1213012..1214397)
Genome map
AA seq 461 aa AA seqDB search
MQSSQSHVPFTTKLAIFGLAGLAFCGVLIETSMNVTFPTLMKQFDVSLNTVQWITTAYLL
VVAAVISVAAFMERRYLFKQLFFVAAAMILIGIFICGSATSFPMLLVGRIVQAISTGITM
PLLIAEIMQEIPLAKQGSYMGIGGMVIALAPSLGPTYGGLVTQNLSWRFIFWLILPIAII
ASVVGLLFIKQGSAPQKSKFPWSQFVSFVLALIMLTLGVNNAGNYGWNAIQFYGYVIIGI
LFLGLFVYLAQRSQTPLINLSIFKHWAFTLPLIIYFSIQFVQLSLTFLLPNYAQLVLHQG
TFISGFMLFAGSLASSILAPITGRILDEYGIGKPLLIGSGFILMATLGFVVFHNNLNVGL
IAILYALYAIGFSFMFNNSLTSALQNIPPQLIGDGNATFNTLQQYAGSMGTAIASAMLIG
HGTQHISVIQQTANGATSEFILVFIVCIVVSGLAVLVQRKS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcaagtcagtcacacgttccttttacaactaaacttgccatttttggattagca
ggtttagcattttgtggtgttttaatcgaaacttcgatgaacgtcacgtttccaaccctc
atgaaacagttcgatgtttcgctaaacaccgtccaatggatcacgacggcgtatctatta
gtagtcgctgcggtgatttccgttgcggcatttatggaacgccggtacttattcaaacag
cttttctttgtcgccgcggccatgatattaattggtatttttatttgtggatcagccact
agttttccgatgttgctagtgggacgcattgttcaagccatcagcacaggaattaccatg
cccctgttaatcgccgaaattatgcaagaaattccgctggctaaacaaggaagctacatg
ggaatcggcggaatggtgatcgcattagcgccatcgctcggtcccacatatggcggcctt
gtgactcaaaacttgtcctggcgatttatcttttggttaattctaccaatcgcaataatc
gcaagtgttgtgggccttttatttatcaaacaaggatcagcaccgcaaaaatcgaaattt
ccttggagtcaatttgttagttttgtcttagccttaattatgcttactttgggagttaat
aacgctggaaattatggttggaacgcgatccaattctatggatacgtaattattggaata
ctctttttaggcctttttgtttacttggcacaacgatcccaaacaccgttaattaatcta
tcaatttttaagcactgggctttcacattaccgctaattatttatttttccattcagttt
gttcagctttccctcacatttttactaccaaattacgcgcaacttgtcttacatcaaggg
acgtttatttctggtttcatgttatttgcaggaagtttggcatcgtccattttggcacct
attactggcagaattttagatgaatatgggattggcaaaccactattaatcggtagtggc
ttcattttgatggctactttaggttttgtagtttttcataacaatctaaacgtcggatta
atcgcaattctatatgccctctacgcgattggattcagttttatgtttaataattcttta
acatcagcattgcagaatattccaccacaattgatcggtgacggaaatgccacttttaat
acgctgcaacaatacgctggatccatgggaaccgcgattgcttcggcaatgttaataggc
cacggaactcaacacattagtgtaattcaacaaacagcaaatggggccacttcagaattc
atactggtcttcatcgtttgtatagtggtgagtggattagccgtccttgtgcaacgaaaa
tcataa

DBGET integrated database retrieval system