KEGG   Prevotella denticola: HMPREF9137_0422Help
Entry
HMPREF9137_0422   CDS       T01459                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pdn  Prevotella denticola
Brite
KEGG Orthology (KO) [BR:pdn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HMPREF9137_0422 (ahpF)
Enzymes [BR:pdn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HMPREF9137_0422 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like Thi4 DAO FAD_oxidored AlaDh_PNT_C NAD_binding_7 NAD_binding_8 Glutaredoxin Lycopene_cycl FAD_binding_3 K_oxygenase DSBA
Motif
Other DBs
NCBI-ProteinID: AEA21106
UniProt: F2KUW3
LinkDB All DBs
Position
complement(488731..490290)
Genome map
AA seq 519 aa AA seqDB search
MLDPDILKQVRSVFSSLSSDITLSVVRKSDEAQSAEFSAFVEDIASVSDRVSTVCREGER
FSFSILRNGEATGISFRGIPNGHEFTSLLLAILNADGQGKNLPDEAVAARIKALKGEIRL
QTYVSLTCTNCPDVVQALNVMALINPDISNEMVDGGLYQDEIERLGIQGVPAVYVNGEPL
HVGRGDLGVLLQELEDKVGTDHDRAAVQPVRTYDVLVLGGGPAGVSAAIYSARKGLKVAV
VAERIGGQVNDTTGIENLVSVARTTGTQLAADFRTHLSDYPIDIFDNRQVVAANLKDGQK
TVSVRGGETFAAPAVVIATGAGWRRLGLAGEERYIGHGEHFCPHCDGPFYKGKDVAVIGG
GNSGIEAAIDLAGICRHVTVLEFAEALRADEVLQRKVAGLPNVEVSLSAQTTALLGDGQK
LSGITVKDRISGEERNISLDGVFVQIGLSPNSDVFRNEVKLTPRKEIVIDVANRTSLPGV
YAAGDVTTVPYKQIAIALGEGAKAALSAFEDRIRGVIIG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttagatccagatatacttaaacaggtgagaagcgtcttcagttcgctctcatcagac
attacgctcagtgtcgtacgtaaaagcgacgaagcacagtcggcagagttttcggctttt
gtagaggacatcgcttctgtctccgacagagtcagtactgtctgtcgggagggtgaacgg
ttctcgttcagcatcctccgaaatggagaagcaaccggaatcagtttccgcggtatcccc
aacggccatgagttcacctcgctcctccttgccatcctcaatgctgacggacagggaaaa
aaccttcccgatgaggctgttgcggcacgcatcaaggcactgaaaggtgagatacggctt
cagacttacgtctcccttacctgtacgaactgtcccgacgtggtgcaggccctgaacgtg
atggcgctcatcaaccctgacatcagcaatgagatggtggacggaggattgtaccaggac
gaaatagaacgtctgggcatacagggtgttcctgccgtctatgtcaatggcgaaccgctc
cacgtgggacgcggcgacctcggcgtgctgttgcaggaactggaagacaaggtcgggaca
gaccatgacagggcggccgtacagcctgtccgtacgtatgatgtccttgttctcggcggc
ggacctgccggtgtgtcggccgccatctattccgcccggaaggggctgaaggtggccgtt
gtggcagaacgtatcggcggacaggtgaatgacacgaccggcatcgagaaccttgtctcg
gtcgccaggacaaccggcacgcagctcgcagccgatttccgcacgcatctttcagactat
ccgattgatatattcgacaaccggcaggtagttgccgcaaacctgaaagacgggcagaag
acggtctctgtacgtggtggagagactttcgccgcacccgcagtggtgattgccacaggt
gccggctggcgtcgtctcggtctggctggtgaggaaaggtacatcggccatggcgagcac
ttctgtccgcattgtgacggtcctttctacaaaggaaaggatgtcgcggtcatcggtggc
ggtaattcgggcatcgaggctgccattgacctggccggcatctgccgtcatgtgaccgtc
cttgaatttgccgaagcactgcgtgccgatgaggtgctgcagcggaaggtcgccggtctt
cccaatgtggaagtgtccctgtctgcccagacaacggcgcttctgggtgacggacagaag
ctgtcgggcatcacggtgaaagaccgtatcagcggtgaggaacgcaatatttccctggac
ggcgttttcgtacagattggtctgtcgccgaacagcgatgtcttcaggaacgaagtaaag
ctgactccgcgcaaggagattgtcatcgacgtggccaaccgtaccagtctgcctggtgta
tacgctgccggcgacgtgacgacggttccttacaaacagattgcgattgccctgggtgag
ggggccaaggctgccctgtctgcctttgaagaccgcatccgtggggtgattataggataa

DBGET integrated database retrieval system