KEGG   Prevotella denticola: HMPREF9137_0675Help
Entry
HMPREF9137_0675   CDS       T01459                                 

Definition
(GenBank) hypothetical protein
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
pdn  Prevotella denticola
Pathway
pdn00500  Starch and sucrose metabolism
pdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9137_0675
Enzymes [BR:pdn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     HMPREF9137_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C DUF3597
Motif
Other DBs
NCBI-ProteinID: AEA21821
UniProt: F2KWH3
LinkDB All DBs
Position
804032..806170
Genome map
AA seq 712 aa AA seqDB search
MKKTYIALLGLLMGMASIADAQTVKSPDGNIAVTFSLTGNGVPTYEMTYKGKAVVKPSHL
GLELAKDRHASKGMRETSLMDGFEKTGTRTTTFDETWKPVWGETATIRNHYNELEVDLSQ
PSSRRNIIIRFRVYDDGMGLRYEFPQQPELNYFIIKEEHTQFAMAGDHTAWWLPGDYDTQ
EQETQESKLSEIRSRFHDAVNWGNSSVDVFSETGVQTSLQMKSADGLYINIHEAACADYA
TMHLNLDDKTMTFESWLTPDATGLKGFMQTPCETPWRTVMVSDDARDMLASNLILNLNEP
CKIEDTSWIHPTKYCGVWWEMIAGGKPWAYTDEFSSVKLGQTDYAHAKPNGRHPANTANV
KKYIDFAAANGMQEVLVEGWNIGWEDWFGHWKQDVFDFVTPYPDFDLKGLNEYAHSKGVK
LLMHHETSSSALNYERHLEDAFNLMNKYGYDAVKTGYVGDIIPRGDHHYSQSMNNHYLRV
VKEAARHHIMVNAHEATRPTGLCRTWPNLVGNESARGTEYEAFGGSDPNHTVILPFTRLQ
GGPMDYTPGILETQLSTWCNNKSYVHTTLVGQLALYVTMYSPLQMAADLPENYQKYNDAF
QFIKDVACDWDDSRYLEAEPARYITVARKAKGTDNWFIGGKTGLAAHQSTVRLDFLDKGR
RYEATVYADAKGADYEKNPKAYTITKRTVKKGDVLKLWEARGGGFAISLKAL
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacctacattgcccttctggggctactgatggggatggcaagcattgccgat
gcgcagaccgtgaagtctcccgacggcaatatcgctgttaccttttcgctgacaggaaac
ggcgtgccgacctacgagatgacttacaaaggtaaggctgtcgtgaaaccttcacattta
ggacttgaactggccaaggacaggcatgccagcaagggcatgagggaaaccagcctcatg
gacggttttgagaagaccggcacccggacgactactttcgacgagacatggaagccggta
tggggcgagacggctaccatccgcaaccactacaacgagctggaggtagacctcagccag
ccttccagcagacgcaacatcatcatccgtttccgtgtctatgacgacggcatgggactc
cgctatgagttcccgcagcagcccgaactgaactattttatcattaaagaggagcatacg
cagtttgccatggccggcgaccacacagcctggtggcttcccggcgactatgacacgcag
gagcaggagacacaggagtcgaagctctcggagattcgttcgcgcttccatgatgccgtg
aactggggcaactcctctgtagacgtgttctcggaaacgggtgtacagacctccttgcag
atgaagtctgccgacggtctctacatcaacatccacgaggcggcatgtgctgattatgct
actatgcacctcaacctcgacgacaaaacgatgaccttcgagtcgtggctcacgcctgat
gcgacaggtctgaaaggatttatgcagacgccttgcgagaccccatggcgtacggtgatg
gtaagcgacgatgcacgggatatgctggcaagcaatctcattcttaacctcaacgaaccc
tgcaagatcgaggacacttcctggattcatcccaccaagtactgcggtgtgtggtgggag
atgatagcaggtggcaagccgtgggcttatacggatgagttcagttccgtgaagctcggg
cagaccgactatgcgcacgctaagcccaacggccgccatccggcgaacactgccaacgtg
aagaagtatatcgacttcgctgcagccaacggaatgcaggaggtgcttgtggaaggctgg
aacataggttgggaggactggttcggccactggaagcaggatgtgttcgacttcgtcaca
ccttaccctgacttcgacctcaagggtctgaacgagtatgcccactcgaagggtgtgaaa
cttctcatgcaccacgagacctcttccagtgcgctcaactatgaacgtcacctcgaggat
gcgttcaatctgatgaacaaatacggctatgatgccgtgaagaccggctatgtaggcgac
atcatcccgcgcggcgaccatcactattcacagtcgatgaacaaccactacctccgtgtc
gtcaaggaggctgccaggcatcatatcatggtgaacgcacacgaagcgacacgtcctacc
ggtctctgccgtacatggcctaacctcgtcggcaacgagtcggcacggggcacggagtat
gaagcattcggcggcagcgaccccaaccacactgtcatcctcccgttcacccgtctgcag
ggcggtccgatggactacacgccgggaattcttgaaacgcagctgtcgacctggtgcaac
aacaagagctatgtacacacaacgcttgtcggacagcttgccctttatgtgacgatgtac
agtccgctccagatggccgccgacctcccggagaactaccagaagtacaacgatgccttc
cagttcatcaaggatgtagcctgcgactgggacgacagccgttaccttgaggccgaaccg
gcacgctacattaccgtagcccgcaaggccaaggggaccgacaactggttcataggcggc
aagaccggactggctgctcaccagagtacggtcaggctcgacttcctcgacaagggccgc
agatacgaggcgacagtctatgcagatgccaaaggcgcagattacgagaagaacccgaag
gcatacaccatcaccaagcgtacggtgaaaaagggcgatgtgctcaagctctgggaagca
cgtggcggtggcttcgccattagcctgaaggcgctgtaa

DBGET integrated database retrieval system