KEGG   Prevotella denticola: HMPREF9137_1930Help
Entry
HMPREF9137_1930   CDS       T01459                                 

Definition
(GenBank) HAD hydrolase, family IA, variant 3
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
pdn  Prevotella denticola
Pathway
pdn00630  Glyoxylate and dicarboxylate metabolism
pdn01100  Metabolic pathways
pdn01110  Biosynthesis of secondary metabolites
pdn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HMPREF9137_1930
Enzymes [BR:pdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     HMPREF9137_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: AEA20310
UniProt: F2KWD7
LinkDB All DBs
Position
complement(2250140..2251084)
Genome map
AA seq 314 aa AA seqDB search
MSIPQRLQNLSFRTGVVVLLLCVPFYVLSFTQLLLPISVSAKGILWTVLFGLAKAFQYGG
IAILGAEGYRRVRGWFWKKRTAPGAAASVTARQPRVRYCPDLFADPAILEGIRLVIFDFD
GTLGDSRQLITDTMLATIERLGLPRRSREACARTIGLPLKQCFSSIIPMTDSQAERCAAT
YRELFDEKNVPGAVTVFPGVCKTLEHLAERGITMSIASSRRRESLVGLVRDLQLSPFITF
LVGADDVEHQKPAADPVALTLRHFSVRPDEALVVGDTEYDILMGRNAGVHTCGVIYGNGS
RESLEAAGAEWIVC
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcccgcaaagactgcagaacctctctttccgcacaggtgtcgtcgtgctgctc
ctgtgcgtacctttctatgtcctgtccttcacgcagctgctccttccgatttccgtaagc
gcaaagggaatcctttggacggtgctgttcggactggcaaaggccttccagtacggcggc
atagccatcctcggtgcggaaggctaccggcgtgtcaggggatggttctggaaaaagaga
accgctcccggtgccgcagcctctgtgacggcacggcagcctcgggtgcggtactgtccc
gaccttttcgccgaccctgccattctcgagggcatccgcctcgtcatcttcgacttcgac
ggtacgctcggcgactcccggcagctaatcaccgacacgatgctcgccactatcgaacgg
ctcggactgccccggcggagccgtgaggcgtgtgcccggaccatcggtctgccgctgaag
caatgcttctcttccatcattccgatgaccgacagccaggcggaacggtgtgccgccact
tacagggagctgttcgatgagaaaaacgtgcccggtgccgtgaccgtcttccctggtgtc
tgcaagacgctggaacaccttgcggagcgaggcattacgatgtccatcgccagcagccgt
cgccgtgagtcgcttgtcggactggttcgcgacctgcagctctcgcctttcatcactttc
cttgtcggggcggatgacgtggaacaccagaaaccggccgccgatcctgtcgcccttacc
ctgcgccatttcagcgtccgtcccgatgaggctctcgtcgtgggcgataccgagtacgac
attctcatggggcggaatgcaggtgtacacacctgcggcgtgatctacggaaacggcagc
cgggagagtctggaggcagcgggtgcagaatggatcgtctgctga

DBGET integrated database retrieval system