KEGG   Prevotella denticola: HMPREF9137_2064Help
Entry
HMPREF9137_2064   CDS       T01459                                 

Definition
(GenBank) Beta-ketoacyl synthase, C-terminal domain protein
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
pdn  Prevotella denticola
Pathway
pdn00061  Fatty acid biosynthesis
pdn00780  Biotin metabolism
pdn01100  Metabolic pathways
pdn01212  Fatty acid metabolism
Module
pdn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pdn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HMPREF9137_2064
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HMPREF9137_2064
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pdn01004]
    HMPREF9137_2064
Enzymes [BR:pdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     HMPREF9137_2064
Lipid biosynthesis proteins [BR:pdn01004]
 Fatty acid synthase
  Component type
   HMPREF9137_2064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ketoacyl-synt_C ketoacyl-synt Thiolase_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEA21585
UniProt: F2KX72
LinkDB All DBs
Position
2419329..2421062
Genome map
AA seq 577 aa AA seqDB search
MVYVLADNIISPLGDTSEDNYRAIKAGRSGLRAYAPMTDGIPDGFTASLLPDDFEELVCR
SAGKAIDAAGIDVSDQRSVFILSSTKGAIEQLGKTADEDLYLGRTAQRISVRLGFRTPPV
AVCNACISGSAAMILACRLLQSGGYDHAVVCGADCPGRFIISGFQSLNAMSAEACRPFDI
ERQGMNLGAAAATVVLGSRLSPGRRSSGRADERIWQIGHGYIRNDAFHISTPSKTADGLT
AALQQTLEEVGKEDIAFVNAHGTATLFNDQMEAVALRRAGLSDLPVNALKGYIGHTLGAA
GIFETILGMKSVDDHTVLGTRGYREAGVSGKVLMAQEHRPTDRHSFLKMLSGFGGCNATL
YARSAAVRSNSPDERGEAAAHTVPELRKPHSVHITPDGAWVDGETFPVNAGREGNSLLTA
VYKQMGGDYPKYYKMDGLCRLGFIASELLLRAEQTGGTLPGGLDRSRAVVLFNRSSSVAS
DKRYLSSIADKDNYFPSPSVFVYTLPNIVAGEIAIRNGYHGETSFYILPEKDEQQMETLM
RTAFMDRQTTSLLAGWIDYEDCGHFEADLYTVYINKV
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggtttatgtattagctgacaacatcatttcccctctgggcgatacgtcagaggacaat
tatcgggcgataaaggccggtaggtcgggcctgcgtgcctatgccccgatgaccgatggc
atccctgatggctttacggcctccctgttgccggatgactttgaagagctggtctgccgt
tctgcaggcaaggccattgatgcggcggggattgacgtgtcggatcagcgctcggtgttc
atcctgagttctaccaaaggtgcaatagagcaattggggaagactgcggatgaagacctg
tatctgggcaggacggcacagcggatctccgtccggctgggcttcaggacccctcctgtt
gcagtatgcaatgcgtgcatttccggttcggccgcgatgatcttggcctgcagattgctg
cagtcggggggttatgaccatgccgtcgtatgtggcgccgactgtcccggacgtttcatc
atctccggattccaatcgctgaacgccatgtcggctgaggcttgccgtcctttcgatata
gaacgtcagggaatgaacttaggtgcagcagctgcaacggtggtactgggcagtcgtctt
tctcccggcaggcggagcagcggcagggcagatgaacggatatggcagataggacacggg
tacataaggaatgatgcctttcatatcagtacgccgtcgaagacggccgacgggctgacc
gccgcattgcagcagacattggaagaagtcggcaaggaggacatcgcctttgtcaatgcc
catggaacggccactctttttaacgaccagatggaggctgtcgccctccggcgggccggt
ctttccgacctgcctgtcaacgcattgaaaggctatatcggacatacactgggtgccgca
ggtatttttgaaacgattctcgggatgaagtccgttgatgaccataccgttttaggcacc
cggggataccgggaggccggggtgtcgggtaaggtgctgatggcccaggaacatcgtccg
acggacaggcattcctttctgaagatgctctccggcttcggcggctgtaatgcgacactt
tatgcaagatccgcagcggtccgcagtaacagtcccgatgaaagaggagaggcggccgcc
catacggttccggaactcaggaagccgcattctgtacacatcactcctgacggtgcatgg
gttgacggcgaaacctttcctgtcaatgccggacgggaggggaacagtctgcttacagct
gtctataaacagatgggaggtgattatccgaagtattacaagatggatggcctgtgccgg
ttgggattcatcgcatcagagctgttgctgcgggcggagcagacaggaggaacacttccc
ggcggactcgaccggagcagggcggtcgtgcttttcaaccgctcctcctctgtcgcttct
gataagcgttacttgtcgtcgatagccgacaaggacaattatttcccgagcccgtccgtc
ttcgtatatacattgccgaacatcgtagcaggtgagattgccatccgcaacggatatcat
ggagagacttccttctacatccttccggaaaaggacgaacagcagatggaaacgctgatg
cggaccgccttcatggacaggcagacgacaagtctgctggcgggatggattgattatgag
gattgcggacatttcgaagccgacctgtatacggtatacattaacaaggtataa

DBGET integrated database retrieval system