KEGG   Parascardovia denticolens: PSDT_1090Help
Entry
PSDT_1090         CDS       T03978                                 

Definition
(GenBank) putative amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pdo  Parascardovia denticolens
Pathway
pdo00500  Starch and sucrose metabolism
pdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSDT_1090
Enzymes [BR:pdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PSDT_1090
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PSDT_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Glyco_hydro_114
Motif
Other DBs
NCBI-ProteinID: BAR05609
UniProt: E6K138
LinkDB All DBs
Position
1329236..1330906
Genome map
AA seq 556 aa AA seqDB search
MSNEAKQWLEDAVFYEIYPQSFYDSNGDGIGDIPGISVKLDYIRDLGCNALWINPCFDSP
FKDAGYDIRDYTKVAPRYGTNKDLIDLFGQAHEKGMHVLLDLVPGHTSEEHPWFKASSEA
ARGSFSDRYIWTRSAFEAPQGQPFIAGESERDGAYVLNFFKCQPALNYGYAHPDKPWQWM
AGSEPARRTEEAMSEVIRYWLSRGCDGFRVDMADSLVKFDGDDKTYTIEAWKRIFAPIKK
DFPAAAFVSEWGRPWLSFKAGFDMDFYLDWRWDKPNGYNRLLRNTDSTLVRESDLSYFNA
DSPSSPIDFLNDYLPQYTGGKQINKDGSFSFITCNHDTPRIAPRLRPEEIKLAYAMIFTM
PGVPFLYYGDELGLHYRNLPTKEGGYGRTGSRTPMQWTSYDPRTNPTCGFSQADPQDLYL
PVDEQDDGISAAAERDDPDSLLNFVRKLLALRHRYPALRSTSDWEVINAESGLRSLTYLR
KDPEGQDDISVCINPGRKAETVTFEFPRPRRHKLLLSIGGEPEVESRPEERTDGYGRRPS
IFRVTFPPQSVCIHLV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaggcgaaacagtggttggaagacgccgtcttctatgaaatctacccgcaa
agtttttatgattccaatggggacggaatcggcgacatcccgggcatcagcgtcaagctg
gactatatccgggacctgggctgcaacgccttgtggatcaacccctgcttcgactcccct
ttcaaggacgccggctacgacatccgggactataccaaggtggccccgcgctacgggacc
aataaagacctgatcgatctcttcggccaagcccacgaaaaaggcatgcatgtgcttctg
gacctggttcccggccatacgagcgaagagcatccctggttcaaggccagcagcgaagcc
gcccgtggcagcttctccgaccgctacatctggacccgatccgccttcgaagccccgcaa
ggccagcctttcatcgccggcgagagcgagcgcgacggggcttacgtcctgaatttcttc
aaatgccaaccggcgctgaactacggttacgcccatccggacaagccctggcagtggatg
gccggaagcgaaccggcccgcaggacggaagaggccatgagcgaggtgatccgctactgg
ctctcccgcggctgcgatggtttccgcgtggacatggccgattccctggtcaagttcgac
ggggacgacaaaacctacaccatcgaggcttggaaacggatcttcgcccccatcaagaag
gacttccccgccgccgccttcgtctccgaatggggacggccctggctctccttcaaagcc
ggtttcgatatggatttctatctggattggcgttgggacaagccgaacggatataaccga
ctcctgagaaacaccgactccaccctggtccgcgagtcggacctcagctatttcaacgcc
gattccccctcctcccccatcgatttccttaacgactatctgcctcaatacaccggcggc
aagcaaatcaacaaagacggcagcttcagcttcatcacctgcaaccacgacacgccccgc
atcgccccccgcttgcggccggaggagatcaaactggcctatgccatgatcttcaccatg
ccaggggtccccttcctttattacggggacgagctgggcctgcattaccggaatctgccc
accaaagaaggcggctacggccggaccgggtcgcggacccccatgcagtggacctcttat
gacccccggaccaaccccacctgcggattctcccaggcggatccccaggacctctacctg
cccgtggacgagcaggatgatgggatcagcgcggcggccgagcgggacgatcccgattcc
ctcctgaacttcgtcaggaagctgctggccttgcggcaccgctaccccgccctccggtcg
acttcggactgggaggtcatcaacgccgaatccggcctgcgctctctgacctatctgagg
aaggacccggaagggcaggacgacatttcggtctgcatcaaccccggcaggaaggcggaa
acagtgaccttcgagtttcccaggcccaggcggcacaaactgctcctgagcatcggaggc
gaacctgaggtggagagtcggccggaagaaaggaccgatgggtacggccgacgcccgtcc
atcttccgggtgaccttccccccgcaaagcgtctgcattcatctggtatga

DBGET integrated database retrieval system