KEGG   Parascardovia denticolens: PSDT_1448Help
Entry
PSDT_1448         CDS       T03978                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pdo  Parascardovia denticolens
Pathway
pdo00620  Pyruvate metabolism
pdo00680  Methane metabolism
pdo01100  Metabolic pathways
pdo01120  Microbial metabolism in diverse environments
pdo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSDT_1448
  09102 Energy metabolism
   00680 Methane metabolism
    PSDT_1448
Enzymes [BR:pdo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PSDT_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAR05967
UniProt: E6JZ29
LinkDB All DBs
Position
1757602..1760439
Genome map
AA seq 945 aa AA seqDB search
MMTEASQTSPISSTSPIPPTGQGAQRPWEEPEEAGDTRQFIAFNARQVGEETALPPALRT
DMDLVLQILRKILGEYNPEILAKFDSLREDVIVASQEQFHKDGEGSDFHTAAKRSLDEVV
GLIDDISMDDAQALARAFGTYFHLANLCEENYRMSVLLERENQVDTTASVDPLNAISVAY
KQLIDEVGPAGAQELLEKLEFHPVFTAHPTEARRKAVEGKIRRIANLLAIRKHQGGSLLT
ETDRQLYQEIDSLYRTSPIAFKKPTPVEEADTILDIFDNTLFTMIPRVYRRFDNWILGKK
AGTVPPVCPAFFHPGSWIGSDRDGNPNVTAKVSRKVALKFYNHMLETLARATHAVGRNLT
LGSRTTPANEELKALWSRQKELSEKLTGQAEILSTKEPHRACLFVMSDRLRATRDRNADL
MYSSSEEFLADLRIVQKSLAEAGAVRSAYGPVQDLIWQVETFGFHMVQMEFRQHSLVHAR
ALDDIREHGLHGERGPLAPMTQEVLSTFRAIGAIQKHNGRQAAGRYLISFCKSAQHVRDV
YELNRLAFADPKDAPVLDVIPLFEQLEDLENSVSTLDEIIKIPEVKNRLKQTGNRMEVML
GYSDSSKDAGPTSATLALHRAQGRIADWAKRHEIDLTLFHGRGGAVGRGGGPANRAVLAQ
PVGSVNCRFKVTEQGEVIFARYGNPVLAARHVEAIASAILLQSAPSVEKINTDMTAKYQH
MADALDLASREKYVSLLTAPDFAPWFSVVTPLTEIGLLPIGSRPAKRGLGAQSLDDLRTI
PWVFSWAQARINLAAWYGLGTACEKFADLGQLQAAYREWPLFTTFIDNIEMSLAKTDERI
ARMYLSLGDRDDLSAAVLDEMALTRRWVLQIVGDDWPLEHRHILGQAIRIRSPYVDALSI
TQVRALGSLRRRTDKAELSESQTADYIYLILCTVSGVAAGLQNTG
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgatgactgaagcatcgcaaacatcaccgatatcatcaacatcaccgattccaccgacg
gggcaaggggcgcagcggccctgggaagagccggaggaagcgggggacacccgccagttc
atcgccttcaacgcccggcaggtcggggaagaaaccgccctgccgccggccttgcggacg
gacatggacctggtactccagatcctgaggaaaatcctgggagaatacaatccggagatc
ctggcgaaattcgactctttgcgtgaagacgtgatcgtggccagccaggaacaattccat
aaggacggggaaggctccgacttccatacagcggcgaaacgcagtctggacgaggtcgtc
ggcctgattgacgatatctccatggacgacgcccaggccttggcccgcgccttcggaacc
tacttccatctggccaacctctgcgaagagaactaccgcatgtccgtcctcctggaaagg
gagaaccaggtggacacgaccgcttccgtggacccgctcaacgccatctccgtggcctat
aaacagctgatcgacgaagtcggccctgccggggctcaggaactgctggaaaagctggaa
ttccacccggtctttaccgctcaccccaccgaagccaggcgcaaggccgtggaagggaag
atccgtcgcatcgccaacctcctggccatccgcaaacaccagggtgggtctctcctgacc
gaaacggaccgtcagctttaccaggagatcgactccctctaccgcacctcccccatcgcc
ttcaagaagccgaccccggtggaggaagcggacaccatcctcgacatcttcgacaatacg
cttttcaccatgatcccccgggtctaccggcgcttcgacaactggatcctgggcaagaag
gcgggcacggtacccccggtctgcccggccttcttccaccccggcagttggatcggctcc
gaccgcgacggcaaccccaacgtgaccgccaaagtcagccggaaagtggccctcaagttc
tacaaccacatgctggagaccctggcccgggccacgcacgccgtcggccgcaacctgacc
ctaggctcccggaccacccccgccaacgaagagctcaaagccctctggagccggcaaaag
gagctgagcgaaaagctgaccggccaggccgagatcctctccaccaaagaaccccatcgg
gcctgccttttcgtcatgtccgaccggcttcgggccacccgcgaccgcaacgccgacctc
atgtactcctcatccgaagagttcctggccgacctgcgcatcgtgcagaagtccctggcc
gaagccggggccgtccgcagcgcttacggccccgtccaggacctaatctggcaggtggag
accttcggcttccacatggtccagatggagttccgccagcattccctggtccatgcccgc
gccttggacgacatccgcgaacacggcctccacggggaacgcgggcccctggcccccatg
acccaggaggtcctcagcaccttccgcgccatcggagccatccagaagcacaacggccgc
caggcggcgggccgttatctgatctctttctgcaaaagcgcccagcacgtgagggacgtc
tacgagctcaaccggctcgctttcgccgaccctaaagacgcccccgtcctggatgtgatc
cccctcttcgagcagctggaggacctggagaattccgtttccaccctagacgaaatcatc
aagatacccgaagtgaagaaccggctcaagcagaccggcaaccggatggaagtcatgctg
ggctactctgattcgtccaaagacgccggacccacctccgcaaccctggccctgcatcgg
gcccaaggccgtatcgccgactgggccaagcggcatgagatcgacctgacccttttccac
ggccgaggcggggccgtcggtcgaggaggcggccccgccaacagggcggtcctggcccaa
ccggtcggctcagtcaactgccgcttcaaggtgaccgaacaaggcgaagtgattttcgcc
cgctacgggaacccagtcctcgccgcccgccacgtggaggccatcgcgtcggccatcctg
ctccagtcggcccccagcgtggagaagatcaacacggacatgaccgccaaataccagcat
atggcggacgctttggacctggcctcccgggagaaatacgtgagcctgctcaccgccccc
gatttcgccccctggttctccgtggtcacgcctttgaccgagatcggcctcctgcccatc
ggctcccggccggccaagcgcgggctgggcgcccaatccttggacgacctgcggaccatc
ccttgggtcttctcctgggcccaggcccgcatcaacctggctgcctggtatgggctgggc
accgcctgcgagaagttcgccgacttggggcagctgcaggccgcctaccgcgaatggccc
ctgttcaccaccttcatcgacaacatcgagatgtctttggccaagaccgacgaacggatc
gcccgcatgtacctgagcctgggcgaccgggacgacctcagcgcggcggttttggacgag
atggccctgacccgccgatgggtcctgcagatcgtcggcgacgactggcctctggaacat
cggcacattctggggcaggccatccgtatccggtcgccttatgtggacgccctgtccatc
acccaagtgagggcactgggctccctgcggcggcggacggacaaggccgaactgagcgaa
tcccagaccgccgattacatctacctgattctgtgcaccgtgtccggcgtcgccgccggc
ctgcagaacacgggctga

DBGET integrated database retrieval system