KEGG   Penicillium digitatum: PDIP_06960Help
Entry
PDIP_06960        CDS       T04849                                 

Definition
(RefSeq) Succinate dehydrogenase subunit Sdh1, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pdp  Penicillium digitatum
Pathway
pdp00020  Citrate cycle (TCA cycle)
pdp00190  Oxidative phosphorylation
pdp01100  Metabolic pathways
pdp01110  Biosynthesis of secondary metabolites
pdp01130  Biosynthesis of antibiotics
pdp01200  Carbon metabolism
Module
pdp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pdp_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PDIP_06960
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PDIP_06960
Enzymes [BR:pdp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PDIP_06960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO PAPS_reduct
Motif
Other DBs
NCBI-GeneID: 26229019
NCBI-ProteinID: XP_014538081
UniProt: K9GJE9
LinkDB All DBs
Position
Unknown
AA seq 647 aa AA seqDB search
MSSMSLRSLAPASKVSRILRDQRRLFSSSRPAARIWSNQPLRAKESNGYLTDKYPIIDHE
YDALVVGAGGAGLRAAFGLAEAGFKTACVSKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPASVRELEGYGCPFSRTEDGRIYQRAFGGQSKDFG
KGGQAYRCAAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLLMEDGECRGVIAYNQED
GTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPAELLHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGEV
LDVDENGQEKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAVSHRVRDTASPGKP
HKELSSDAGAQSIKDLDFARTADGPKSTFEIRNAMQRTMQTDVSVFRTQESLDEGVEKVN
KVDQLYAQVGTKDRSMIWNSDLVETLELRNLLTCATQTAASAAARKESRGAHAREDYPDR
DDENWMKHTLSWQKKPHGEVKLSYRAVEANTLDESECKPVPPFKRTY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagctccatgagcctgcggagcctagctcctgcatccaaggtttcccgcattttgagg
gaccagagacgtcttttctcgtcttcaaggcccgcagcccgcatatggtctaaccagcct
ttacgcgccaaggagtccaatggctacctgaccgacaagtaccctatcattgatcacgag
tacgatgcgctcgttgttggtgccggcggtgctggtctgcgcgctgctttcggtctcgca
gaggctggattcaagactgcgtgtgtttccaagctgttccctacgagaagtcacactgtc
gctgcccagggtggtatcaacgctgctctcggaaacatgcacgaggatgactggagatgg
cacatgtacgataccgtgaagggctctgattggcttggtgaccaagatgccatccactac
atgacccgcgaggctccggccagtgttcgcgagcttgaaggctacggttgccccttctcg
cgtactgaggatgggcgtatttaccagcgtgctttcggtggtcagtccaaggatttcggc
aaaggtggccaggcttaccgttgtgccgccgcagccgaccgtactggccacgcccttctg
cacaccctctacggacagtctctccgccacaacaccaactacttcatcgaatatttcgcc
ctcgacctgctgatggaggatggtgagtgccgtggtgtcatcgcatacaaccaggaggat
ggtactctgcaccgcttcaaggcccaccacactgttcttgccaccggtggttacgggcgt
gcctacttctcctgtacctccgctcacacttgcactggtgacggtatggctatggttgct
cgtgctggtctccctaaccaggatcttgaattcgttcagttccaccctactggtatttac
ggtgccggctgcctgatcaccgaaggatcccgaggtgagggtggttacctgctcaactcc
gagggagagcgtttcatggagcgttacgctcctaccgccaaggatcttgcatcccgtgac
gtcgtctcccgctccatgactctggagatccgtgagggccgtggtgtgggacccgagaag
gaccacatctacctccagcttagccacttgcccgctgagctcctccacgagcgtctgccc
ggtatctccgagactgcctcgattttcgctggtgttgatgtcaccaagcagcccattcct
gtcctgcccaccgtccactacaacatgggtggtatccctaccaagtacactggtgaggtc
ctggatgtggatgagaacggtcaagagaaggttgtcccaggtctgtacgcctgcggtgag
gccgcctgtgtgtctgtccacggtgctaaccgtctgggtgccaactccctgcttgatctg
attgtcttcggtcgtgctgtgtctcaccgcgttcgtgacaccgcctcccctggcaagccc
cacaaggagctttcttccgatgctggtgcccagtccatcaaggacctcgactttgcccgt
accgctgatggccctaagtcgacattcgaaatccgcaacgccatgcagaggactatgcag
accgatgtcagcgtcttccgtacccaggagagcttggacgagggtgtcgagaaggtcaac
aaggttgatcagttgtacgcccaggttggcaccaaggaccgcagcatgatctggaactcc
gacttggtggagacccttgagctccgcaacctgttgacttgcgctacccaaaccgctgct
tctgctgccgctcgcaaggagtctcgtggtgctcacgcccgcgaggactaccccgaccgt
gatgatgagaactggatgaagcacacactctcctggcagaagaagcctcacggcgaggtc
aagctgagttaccgtgccgttgaggctaacaccttggatgagtcggagtgcaagcccgtc
cctcctttcaagcgtacctactaa

DBGET integrated database retrieval system