KEGG   Penicillium digitatum: PDIP_08750Help
Entry
PDIP_08750        CDS       T04849                                 

Definition
(RefSeq) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pdp  Penicillium digitatum
Pathway
pdp00020  Citrate cycle (TCA cycle)
pdp00480  Glutathione metabolism
pdp01100  Metabolic pathways
pdp01110  Biosynthesis of secondary metabolites
pdp01130  Biosynthesis of antibiotics
pdp01200  Carbon metabolism
pdp01210  2-Oxocarboxylic acid metabolism
pdp01230  Biosynthesis of amino acids
pdp04146  Peroxisome
Module
pdp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PDIP_08750
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PDIP_08750
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PDIP_08750
Enzymes [BR:pdp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PDIP_08750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 26229198
NCBI-ProteinID: XP_014538260
UniProt: K9H2V4
LinkDB All DBs
Position
Unknown
AA seq 400 aa AA seqDB search
MASETKIKVKTPLVELDGDELILPYLDVDLKYYDLGIEYRDETNDQVTIDAAEAIKKYGV
GVKCATITPDEARVKEFNLKKMWLSPNGTIRNILGGTVFREPIVIPRIPRLVPGWTKPIV
IGRHAFGDQYRAQDRVIPGPGKLELVYTPTGGEPERIQVYDFQGGGITQCQYNTDESIAG
FAHSSFKMALMKGLPLYMSTKNTILKKYDGRFKDIFEEIFQKEYKKDFDAKGIWYEHRLI
DDMVAQMIKSEGGFVMALKNYDGDVQSDIVAQGFGSLGLMTSALATPNGDAYESEAAHGT
VTRHYREHQKGKETSTNPIASIFAWTRGLVQRGVLDNTPEVVTFAEELERACVDVVNEEA
IMTKDLALACGRKDREAWVTTGEYMAAVERRLKANLKAHL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgaaaccaagatcaaggtcaagacccctttggtcgagttggatggtgatgag
ttgattctgccttatcttgatgttgatcttaagtactacgatttgggtatcgagtaccgt
gatgagaccaatgaccaagtcactattgatgccgccgaggctattaagaagtacggtgta
ggcgtcaagtgtgccactatcacccccgatgaggcccgtgttaaggagtttaacctaaag
aagatgtggctctcccccaacggcactatccgcaatatccttggcggtaccgttttccgt
gagcccattgtcattccccgcattccccgcctggttcctggctggaccaagcctattgtt
attggccgtcacgccttcggtgaccagtaccgtgctcaggaccgtgtcatccctggcccc
ggtaagctcgagttggtctacacccccaccggtggtgagcctgagcgcatccaggtctac
gatttccagggtggcggtatcacccagtgccagtacaacaccgatgagtccatcgctggc
ttcgcccactcttccttcaagatggcccttatgaagggtcttcccctctacatgagcacc
aagaacactatcctcaagaagtacgatggccgcttcaaggacatctttgaggagatcttc
cagaaagagtataagaaggacttcgatgccaagggcatctggtacgagcaccgtctcatt
gacgacatggtcgctcagatgatcaagtctgagggtggcttcgtcatggctcttaagaac
tacgacggtgatgttcagtccgatatcgtcgcccaaggctttggctctctcggtctgatg
acttccgctctggccacgcccaacggcgatgcctatgagtctgaggccgcccacggcacc
gtgacccgtcactaccgcgagcaccagaagggtaaagagacctccaccaaccccattgcc
tccatcttcgcctggacccgtggtctcgtccagcgtggcgtcctcgacaacacccccgag
gttgtcaccttcgccgaggagctcgagcgtgcctgtgtcgacgtcgttaacgaggaggct
atcatgactaaggatctggctcttgcctgtggccgcaaggaccgcgaggcttgggtcacc
actggcgagtatatggctgccgttgagcggaggctgaaggccaacctcaaggctcacctg
tag

DBGET integrated database retrieval system