KEGG   Penicillium digitatum: PDIP_15690Help
Entry
PDIP_15690        CDS       T04849                                 

Definition
(RefSeq) Histone deacetylase HosB
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
pdp  Penicillium digitatum
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pdp03036]
    PDIP_15690
Enzymes [BR:pdp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PDIP_15690
Chromosome and associated proteins [BR:pdp03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PDIP_15690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 26229892
NCBI-ProteinID: XP_014537738
UniProt: K9GEN5
LinkDB All DBs
Position
Unknown
AA seq 873 aa AA seqDB search
MEYKLPSTQEDPPIGDNGVKNNNTDEAHKELIDSLNRLTLATATPLPSSPGFPPVPSYAP
SRSVRATRPVPATPQQPNQSVRAVSLQSNQPVRSVSRMAGSVSVRDERRGSIVQLQKRKS
AVSLRSVSQPLKASSPTPDPSRRTSSISAGSPATATSPAMHLARLVSSPAPEAPILTASS
IAAEHFSKELELHRSGGVSTKTAVVVHDDCYGHRYSQLAAPKRTIESIVERPERIRACAV
GISAAYVLLGSRYAEDLALKPRSRLNKPDVPFQIIRTDRKVHLSDAAVTNVHGTQWMSEL
KWMGDHAESRLIADGNELARKRMAEGDGLGTNGPALNAGDLYLCSESVNAFEGALGGICE
GVDLVFKSGPIQRAFVCIRPPGHHCSANFPSGFCWVNNVHVGISHAATTHGLTHAAILDF
DLHHGDGSQDIAYDHNSKLLNKTQRADLAGVNAAKFKEYQDAPPYTKAAIGYYSLHDVNS
FPCENGERDKVMGASLCVDAHNQSIWNVHLEKWADLDGFWKLYETKYNALLIKARSFLRQ
RTIDLNQERQENPSAPPPKAAIFISAGFDASEWEGDGMQRHGVNVPTEFYARFTADIIRM
SQEEGLGVEGRVISVLEGGYSDRALSSGVLSHLSGLSEKSAVKSEWWSPDNLSELDAIIA
APTPSKGRKKSAATYLTATKSFAAKIVAPGRDRKSTEDFDANIVAAPLPEVSWEVATGEL
SKLIIPDGRQTLSCRPAELNRQRREQSAQNGGLDLLIGVEKGRQLRSRKSKESTPMPTTS
RPATPLPATPRRQPHKGPKTTVAATTLPAASCEASPSVGASRRKSISQTRAGTPHRAVSP
LNLPPVPHISTSVGGVRGGPRIILNMPARGTRS
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggaatacaagctcccctccactcaggaggacccgccaataggggacaatggcgttaag
aacaacaataccgatgaggcgcataaggaattaatcgattctctgaatcgcctgactttg
gcgacagcgactccattgccttcatcacctggttttccccctgtgccttcctatgccccc
tctagatctgttcgagccactcgacctgtacctgctactcctcagcagcctaaccaatct
gttcgagctgtctctttacaatcaaatcagcctgtgcgatctgtctcacgaatggccggt
tctgtttctgttcgagacgaacgacgtgggtcaattgtacaactacaaaagcgcaagtcc
gctgtatctcttcgttcggtctcacaaccgctcaaagcatcatctccaactcctgaccct
tcacgccgcacatcatctatctctgcggggtctccagccactgcaacatcgcccgcgatg
catctcgcacggcttgtctccagcccggctccagaggctccaattctgactgcttcgtct
atcgctgctgagcacttctcaaaagagcttgaactacaccgatctggtggtgtcagtacg
aaaactgctgttgttgtccatgacgactgttatggccatcgttactcccagctagcagcg
ccgaaacgaactatcgagagcattgtcgaacgaccggagcgcatacgcgcctgcgctgta
ggcatctctgcagcgtatgttctcctcgggtcccgatatgcggaagatctcgcacttaaa
ccaaggtcgagattgaacaagcctgatgttccttttcaaattatcaggactgatcgcaag
gtgcatttgtccgatgctgctgtgacgaacgttcatggaacccaatggatgtcagaattg
aaatggatgggggaccatgcagagtcccgactcatcgcagatggaaacgaactggccaga
aaacggatggcagaaggtgacggcctcgggacgaatggtcccgctctgaatgccggcgac
ctctacttatgctcagagtctgtgaatgcctttgaaggagcgctaggggggatctgcgag
ggcgtggatcttgttttcaagtctggtccaatccagcgtgcattcgtctgcattcggcct
cccgggcaccattgttcagctaacttcccttccggcttttgctgggtcaacaacgttcat
gtcggaatttcacacgcagcaaccacccacggtcttacccacgcggccattcttgacttc
gatcttcaccatggtgatgggtctcaggacattgcatacgatcacaactccaaattactt
aacaaaacacaacgggccgacttggctggagtcaatgccgcaaaattcaaggaatatcaa
gatgctcctccatacaccaaagcagcaattggctactacagcttgcatgatgtgaactct
tttccttgcgagaatggcgaacgcgacaaagtcatgggtgccagcctctgtgtcgatgca
cacaatcagtctatttggaacgttcatctcgaaaaatgggccgatctcgacgggttctgg
aaattgtacgagacaaaatacaacgcactgctcatcaaagcccggtcattccttcgccaa
cgcacgatcgacctcaaccaggaacgacaagaaaatccaagtgctccaccgcccaaggca
gcaatctttatctcggccgggtttgatgccagcgagtgggaaggcgacggcatgcaacgc
cacggtgtgaatgtaccgactgaattctacgccaggttcaccgcggatatcatccgcatg
tcgcaagaggagggcctcggtgtggaagggcgcgtcatcagcgtcctggagggcggctac
agtgaccgcgcgttgtcctccggtgtgctcagtcatctgtcaggtctgagtgagaaatca
gcggtcaaaagtgagtggtggtctccagataatctgagtgaattagatgccatcatagcg
gctccaacgcccagcaaagggcgcaagaagagtgccgccacctacctgacagccaccaaa
tccttcgcagcaaagatcgtcgcgcccgggagagaccggaagtccaccgaggacttcgat
gccaacatcgtcgctgcccctttgccagaagtgagttgggaagtggccacgggtgagctc
tcgaaactcatcatccccgatggccgccagaccctgagctgccggccggcggagctgaac
cgccagcggcgagagcagagcgcacaaaatggaggtctcgatctcctcatcggcgtcgag
aaggggcgccagctgcgctcgcgcaagtctaaggagtcgacccccatgcccaccacttct
cgccctgccacccctctccctgccaccccacgacgccagccccacaagggcccgaagacc
accgttgccgccacaaccctccccgctgcctcatgcgaggcttccccgtctgtaggtgcc
tcccgtcgaaagagcatcagtcagacgcgcgcgggaactccacaccgggctgtcagcccc
ctgaacctccccccagttccacacatctcgacttccgtggggggagtcaggggcggcccc
cggataattctcaacatgccagcgcggggaacccggtcgtga

DBGET integrated database retrieval system