KEGG   Penicillium digitatum: PDIP_22700Help
Entry
PDIP_22700        CDS       T04849                                 

Definition
(RefSeq) Histone-lysine N-methyltransferase, H3 lysine-36 specific
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
pdp  Penicillium digitatum
Pathway
pdp00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pdp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PDIP_22700
Enzymes [BR:pdp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PDIP_22700
Chromosome and associated proteins [BR:pdp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     PDIP_22700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW Med26 CENP-X DUF4706
Motif
Other DBs
NCBI-GeneID: 26230592
NCBI-ProteinID: XP_014537043
UniProt: K9GCH6
LinkDB All DBs
Position
Unknown
AA seq 887 aa AA seqDB search
MSAHDHADSEEPAKMERQSPVNGNQLKNDSRLSSRSPLPPKKESTLNSDASDQPKENIGE
IVPKQESGQPLKLSRSSSQKVASRPPPLYTHLPDSTQDALATFEQIPGCIYANKYMGYTE
HAMECDCAEEWDPKIGQNIACGEDSDCINRATKIECAGDCGCGSDCQNQRFQKQQFAPVS
VIKTEKKGFGLRAERNLDPGELIYEYVGEVVGEQQFRKRMRQYDEEGIKHFYFMSLNKGE
FVDATKRGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFAERAVQAGEELVFNYNVDRYGA
DPQPCYCGEPMCTGFIGGRTQTERATKLSNATIEALGIDEADGWDTVVAKRPKKKKMEED
DEEYVDSVQPKSLDEDGVTKVMAALVQCQEKWIAVKLLGRIQRCDDERVRNRVVRMHGYQ
ILNSQLAQWKEDQNVVLQILNILDGFPRLTRNKIQDSKIETNIRPLTTCDDERVAKKAVA
LLESWAGLEVAYRIPRMKRGKDAKQAINQFERRETGQEQRQRSLTRSPSPAYDPPRGPAQ
QRRDRGPQRPRQPNRRGPRPLPEGWYTAEAEGRVYYYSASGKTTWERPTLPATSTTSAPG
QPIKNQQNLALQSIIDGIMNTQEDTPSEHRTDTPVTPQASADQPERRQKDGEKWRKLPLE
KQKRIYENTLFPHIKPVVDQYKHKIPDHYLKRFAKETAKKLVESDYKNNRVKDPTAKIST
KHQQTVKTYCKTFFRKAAAKYVDREKLESEKSQGATPNPGSEVPSAGDNEAVAGAHASSP
LEDDDAASLKRKRNGNLNVDGAEDGAASPSKRQKSTPPPPPPPPPPADLPQDDAGGDTCI
GNTEDEPSPPKEGSGAAFNVNVNVNMEMEAATEPQMDQPRLSIEGQV
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcatgaccacgcggactctgaagagccagccaaaatggagcggcaatccccg
gtaaacggcaatcagttgaaaaacgactcgcgtctctcttctcgatctcctcttccgcca
aaaaaagaatccaccctcaactccgatgcatccgatcaaccgaaggagaatatcggcgag
atcgtcccgaaacaagaatcgggccaaccactcaagctgtctcgcagctcgtcgcaaaaa
gtcgcgtcgcgacctccgccgctgtacacgcacctgccagatagtacccaggatgcgctc
gccacctttgaacagattcccggctgtatttacgctaacaaatacatgggatacaccgaa
catgccatggaatgtgattgcgctgaagagtgggacccaaagattggacaaaatatcgca
tgcggcgaggattcagactgtatcaaccgcgcgaccaagatcgaatgtgcaggcgactgc
ggctgtggctccgactgtcaaaatcagcggtttcaaaaacaacagtttgccccggtatcc
gttatcaagacagaaaaaaaggggttcggtttgcgcgcggaaaggaatctcgatccgggc
gaactaatttacgaatacgttggggaggtcgtgggagaacagcaatttcgaaagcgcatg
agacagtatgatgaggagggcatcaagcatttctactttatgtccctgaacaagggcgag
tttgtcgatgcgaccaagcgaggcaacctgggacgattctgcaatcactcgtgcaacccc
aactgctatgtggacaaatgggtcgtgggcgagaagttacgtatgggaatcttcgccgaa
cgcgcggttcaggccggcgaggagctggtattcaattacaatgtggatcgatacggtgcc
gacccccagccctgctattgcggggagccgatgtgcacgggattcatcggcggacgcacg
cagaccgagcgtgcgaccaagctgtcaaacgcaactatcgaggctcttggtattgacgag
gccgatggctgggatacggtggttgcgaaacgaccaaaaaagaagaagatggaagaggat
gacgaggagtatgtggacagcgtgcagcccaagtcgctggatgaggatggtgtgaccaag
gtcatggcagctcttgtgcagtgccaggagaagtggatcgcggtcaaactgcttggccgt
attcagcgctgtgacgacgaacgcgttcgcaatcgcgtggtgagaatgcatggataccag
attttgaattcccaactcgcccaatggaaggaagaccagaacgtggtcctgcagatcttg
aatatcctcgacggattcccgcgactcacccggaacaagatccaggactcgaagattgag
acgaacatccggccgttgacgacctgtgatgatgaacgcgtcgcaaagaaagcagtcgcc
cttctcgagagctgggcgggtctggaagtcgcctaccgaatcccgcgcatgaaacgcggc
aaggacgcgaagcaggcaatcaaccagtttgagcgccgcgaaactggacaagagcagcgc
cagcgatctctcactcgctctccatctcctgcgtatgatcctcctcgtggcccagcacag
caacgaagagaccgaggtcctcagcggcccagacaacccaaccgtcgcggccctcggcca
ttgccggagggatggtacactgcggaggcggagggccgcgtttactactattctgcatca
ggcaaaacaacctgggaacggccaactttacctgctacttctactacttctgcaccgggt
cagcctatcaaaaatcaacagaatttggccttgcagagtatcattgatgggattatgaac
acgcaggaggacacaccctccgagcaccgaactgatacacccgtgactccccaggcctcc
gctgatcaaccggagagaagacaaaaagatggagagaagtggaggaagcttccgctggag
aaacagaagagaatctacgagaacactcttttcccacacatcaagcctgtggtcgatcag
tacaaacataagattcctgatcattatctgaaacgatttgctaaggagactgcgaagaag
ctcgttgaaagcgattacaaaaataatcgcgtcaaggatcccactgcgaagatttccaca
aagcaccagcaaaccgtgaaaacttactgcaagacctttttccgcaaggccgctgccaaa
tatgtggatcgcgagaagctcgagagcgagaaatcgcagggtgccaccccgaaccccgga
agtgaagttcccagcgcaggcgacaatgaagctgtcgcgggtgcacatgcgagttctccc
ctagaagatgatgacgccgcgtccctcaaacgcaagcgaaacggaaacctgaatgttgac
ggtgctgaagatggagccgcctctccctctaaacgacagaaatctacacccccaccgcct
cctcctccgccccctccagccgatctccctcaagatgacgctggtggtgacacctgcata
ggaaacactgaagatgagccttcacctccaaaagaaggctccggtgctgcattcaatgtc
aacgtcaacgtcaacatggagatggaggcggcaacagagccgcaaatggaccaacctcga
ctcagtatcgagggacaggtgtag

DBGET integrated database retrieval system