KEGG   Penicillium digitatum: PDIP_25230Help
Entry
PDIP_25230        CDS       T04849                                 

Definition
(RefSeq) Alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pdp  Penicillium digitatum
Pathway
pdp00052  Galactose metabolism
pdp00500  Starch and sucrose metabolism
pdp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PDIP_25230
   00500 Starch and sucrose metabolism
    PDIP_25230
Enzymes [BR:pdp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PDIP_25230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 GHL15
Motif
Other DBs
NCBI-GeneID: 26230843
NCBI-ProteinID: XP_014536678
UniProt: K9GCW4
LinkDB All DBs
Position
Unknown
AA seq 996 aa AA seqDB search
MVGAKKLLVSAWLLPAAYGAFSTSTTTASGTRSTAASSTSSGGWSQFTIPAGADTGVQLI
ANINDPEAVDAQSVCPGYKASNIKESARGLTATLTLAGKPCNVYGIDVDSLNFSIEYLAN
DRLNVQILPTYLDSSNYSWFVLDELVVPRPTSNHRSSKKHSDLEITWSNEPSFNFKVTRK
ATRDAIFDTTGSVLVFENQFIEFVTSLPKDYNLYGIGEHIQQLRLLRNLTLTLYASDIGD
PIDDNVYGSQPFYLDTRYYEVSHNGHHTLVASDQADQSKDYVSFSHGVFSRNAHGQEIVM
NPEGLKWRTLGGSIDLTFYSGPSQADVTKNYQLSTIGLPALQQYFTFGFHQCRWGYNNWT
QLEEVVSNFDKFEIPLETIWNDIDYMHGYRDFDNDQQRYPYSEGEKFIDKLHSSGRHYVP
IIDAAIYIPNPKNVSDVYDTYTRGHKDDVFLKNPDGSEYIGAVWPGYTVFPDWHNPKTGD
FWANEIVTWHKKIAIDGIWIDMNEVSSFCVGSCGSGNLSMNPSHPPFALPGESGNVIYDY
PENFEVSNKTEAASASTAASRQAAAATGGSVSSSTSYLRTTPTAGARNINYPPYVINHDQ
DGHDLSAHAVSPNATHSDGVQEYDVHNLFGHQILNATYHGLLKVDKKKRPFIIGRSTFAG
SGKWAGHWGGDNASRWAYMFFSIPQALSFSLFGIPMFGVDTCGFNGNTDEELCNRWMQLS
AFFPFYRNHNTLSANSQEPYVWESVTAAAKSAMKIRYAILPYFYTLFHEAHTTGSTVMRA
LAWEFPTDPSLAAVDTQFLLGPSIMVVPVLAPQATSVKGIFPGLKHGEVWYNWYTQTAVE
AKPGVNTTIPAPLGNIPVFVRGGSVLPMQEPALTTKEARATPWSLLVALGVNGAASGQLY
LDDGESNAPDETLDVTFKVKGSILSASASGNWEESNPLATVTVLGVSKKPGDVNFGGRPV
PASGVQYNATSHVLSISGLQKLTKKGAFSEDWTLKW
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atggttggtgcgaagaaacttttggtcagtgcttggctcttgccagcagcctatggtgct
ttctcaacatccaccacaacggcctcgggcactcgctctaccgctgcttcttcgacctct
tcgggtggatggtctcaatttaccattccagctggcgccgatactggcgttcagctgatt
gccaatattaatgaccctgaagccgtcgacgcgcagtcggtttgtcccgggtacaaggca
tcaaacatcaaggaatctgctcgcggattgaccgctactttgacgttagccggaaagcca
tgcaacgtctacggcatcgatgttgactcgttgaacttttccatcgagtaccttgctaat
gaccgcctcaacgttcaaatcctcccgacctatctcgattcttcgaactactcttggttc
gtgttggatgagcttgtcgttccccggcccacttccaaccatcgttcttcaaagaagcat
agtgatcttgagatcacctggtcaaatgaaccctcttttaatttcaaagtgacccgcaag
gctacccgcgatgccatcttcgatacaactggttcggtcctggtgtttgagaaccagttt
attgagtttgttacctccctgccgaaggattataacttatatggcattggagagcacatc
caacagctacgcctcttgagaaatctcacattgactctttatgcgtcggatattggtgac
cctattgatgataatgtttacggctctcagcctttctaccttgatactcgctactatgaa
gttagccacaatggtcaccacaccctggttgcaagtgatcaggccgatcagtccaaagac
tatgtttccttctcgcacggtgtcttctctagaaatgcccatggtcaggagatcgtcatg
aatcccgagggcctgaagtggcgcaccctgggaggtagcatagatctcactttctactcg
ggtcctagccaagcggacgtgaccaaaaactatcagctgagcaccattggcttgccagca
ttgcagcagtactttacttttggcttccaccaatgccgctggggttacaataactggact
cagcttgaagaggttgtctccaactttgacaagtttgaaattccgctcgagactatctgg
aatgacattgattatatgcatggttaccgcgactttgacaatgatcaacaacgttacccc
tacagtgagggtgagaagttcatagataagctgcacagcagtggtcgtcattatgttcct
atcatagacgcggctatctacattccaaaccccaagaacgtctctgatgtctatgatacc
tacacccgtggacacaaggatgacgtcttcctgaagaatcctgatggaagtgaatacatt
ggcgctgtctggcccggctacactgtcttccccgactggcacaatcctaagacaggcgat
ttctgggcaaatgagatcgttacctggcacaagaaaatagccattgatggcatctggatt
gatatgaacgaggtttcttccttctgcgttggcagctgcggatctggaaaccttagcatg
aacccatctcaccctccgtttgcactgcctggagagtctggcaacgttatttatgactac
ccggaaaattttgaggtcagcaacaagaccgaggctgcatctgcatctacagcggcgtcc
agacaggctgccgctgccaccggcggctctgtctcttcgtccacctcttatctgcggacc
acacccactgcgggagcacgcaacatcaactacccgccatatgtgatcaaccatgaccaa
gatggccacgatctcagcgcgcatgccgtgtccccgaatgccactcactcagatggtgtc
caagaatacgatgtgcacaatctcttcggtcatcaaatactcaacgccacctaccatggc
ctgctaaaagtcgataaaaagaagcgtcctttcatcatcggccgctcaacgttcgcagga
tctggtaaatgggccggccattggggtggtgacaatgcctctaggtgggcatatatgttt
ttctctattccccaagccctctcattctccctctttggaattcctatgttcggcgtcgac
acatgtggcttcaatggcaacaccgacgaagaactctgcaaccgctggatgcaactatca
gcttttttccccttctaccgcaaccacaacaccctgtccgcaaactcgcaagagccctac
gtctgggaatccgttacagctgccgctaaatccgccatgaagatccgctacgcaatcctc
ccctacttctataccctcttccacgaggcccacacaaccggctccactgtcatgcgcgcc
ttggcctgggaattccctacagacccctccctcgccgcagtcgacactcagttcctcctc
ggcccatcaatcatggtcgtccccgtgctggccccgcaagcgacttctgtcaagggcatc
tttccgggcctcaagcacggcgaggtctggtacaactggtacactcagacagccgtggaa
gcaaagccaggtgtcaacaccaccatccccgccccgctcggcaatattcccgttttcgta
cgtgggggtagcgttttgccaatgcaggagccagctttgactacaaaggaggcacgtgcc
acgccctggtctttgcttgtcgcccttggtgtcaatggagctgcttccgggcagctatat
ctcgatgatggagagagcaatgctccggatgagacacttgatgttactttcaaggtcaag
ggctccattttgagtgccagtgcgagtggtaactgggaggagtcgaatcctctcgctact
gtaactgttcttggtgtgtctaagaagcctggcgatgttaattttggtggtcgacctgtg
ccagcttctggggtacagtataatgctacctcccatgtcttgtctattagtggcttgcaa
aagttgacaaagaaaggtgctttcagcgaggattggacattgaagtggtag

DBGET integrated database retrieval system